KEGG   Kluyveromyces lactis: KLLA0E15357gHelp
Entry
KLLA0E15357g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
kla  Kluyveromyces lactis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    KLLA0E15357g
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KLLA0E15357g
Enzymes [BR:kla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     KLLA0E15357g
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     KLLA0E15357g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1370741..1377427
Genome map
AA seq 2228 aa AA seqDB search
MSIITPTAPITPPMESTGDRMITLELKDGTTLQGYSFGAETTAAGELVFQTGMVGYPESI
TDPSYEGQILVITFPLVGNYGVPDRKLMDEYVEGLPRYFESNRIHVAGLVIAHYTEEYSH
WLAQSSLGTWLKESNVPAVYGIDSRSLTKHLREAGSMLGRFALQKPGTSFEDANSAEWMS
YFETPEWVDPNVDNLVAKVSLKAPKLFVPNHPDIDLVQGPDGKTLRIVAVDVGMKYNQIR
CFVKRGVELLVVPWDYDFTTEEYDGLFISNGPGNPAILQEVSDRLTKVLDAKKTPVFGIC
LGHQLLARASGASTLKMKFGNRGHNIPCTSTVSGRCYITSQNHGFAVDETSLTNGWKSLF
TNANDGSNEGIYHSELPYFSVQFHPESTPGPRDTEFLFDVFIQSVLDFKQTGVLKQVEFP
GGNIEENLAAHPREDVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNI
ATIQTSKGLADKVYFLPVTAEFVRKVILHERPDAIYVTFGGQTALSVGIEMKDEFETLGV
KVLGTPIDTVITTEDRELFANAMDEINEKCAKSAAAATVAEALEAVKDIGFPVIVRAAYA
LGGLGSGFASNEKELVDLCNVAFASSPQVLVERSMKGWKEIEYEVVRDAFDNCITVCNME
NFDPLGIHTGDSIVIAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPTSKEYC
IIEVNARLSRSSALASKATGYPLAYTAAKLGLNIPLYEVKNSVTRSTCACFEPSLDYCVV
KMPRWDLKKFTRVSTLLSSSMKSVGEVMSIGRTFEEAIQKAIRSTEYSNIGFSETDDELD
IDYELSNPSDMRIFAIANAFAKFGYSIDQVWEKTNIDKWFLNKLYSLIKFSDKISSYGSK
ENLPALVLKQAKQLGFEDRQIAKFLNSNEVAIRRLRKEYGIIPFVKQIDTVAAEFPAHTN
YLYLTYNAAAHDLDFNDHGVMVLGSGVYRIGSSVEFDWCAVTAVRTLRKNNFKTIMVNYN
PETVSTDYDEADRLYFETINLERIMDIYELESSAGVVVSMGGQTSNNIAMSLHRENVKIL
GTSPEMIDSAENRYKFSRMLDQIDVDQPAWKELTSMDEAEDFAEKVSYPVLVRPSYVLSG
AAMNTVYSKDDLESYLNQAVEVSREYPVVITKYIENAKEIEMDAVALDGELIMHVVSEHV
ENAGVHSGDATLIVPPQDLDPETVRRIVEATAKIGRALQITGPYNIQFIAKNNEIKVIEC
NVRASRSFPFISKVVGVNLIEMATKAIMGIPVTPYPVEKLPDDYVAIKVPQFSFPRLAGA
DPVLGVEMASTGEVAAFGHSKYEAYLKSLLATGFKLPKKNILLSIGSYKEKQELLPGVKK
LYNMGYKLFATAGTADFISEHGIPVQYLEVLNEEDDEKSEYSLTQHLANNKIDLYINLPS
ANRFRRPASYVSKGYRTRRMAVDFSVPLVTNVKCAKLLIEALSRNMSLDVSERDAQTSHR
TVTIPGLINISAYVPNISNVLLGPAELKEVTRLSVESGFTYSQIMPKSSSGPVITDAASL
KVANSVVKDSAYTNFGFTVAATPNNIDTVSAVANEATSLFLPYRELSNNVPAVSEHLKHW
PLDKPVIAEAKTSDLASVILLASLQNRSIHITAVSNKEDLSLVMAVKEKQSNVTCDVNIH
SLFVSQDDYPEAKFLPTKEDQEFFWSNLESIDAFSIGSLPTALAAVTGNEIVTGLGIKEA
LPLLLSAVNDGRLTIDDIVERLHINPAKIFSIPEQNSAVEVDLDFTFRHTKRWSPYQKGG
LTGGIQRVLINEETIVLSGDLVATEAKGQPILPSKFTPTTPAVAKETPLAAVGTPILGAI
STSRKRFSFSNERRLSINSMDGDDEEAILDQPLEQRLMSSRPPKELSAPSVLINLIRTKN
PFLRRNILSVNQFKRSDFHALFAVAQELRAGVEREGVLDVMKSRVLTTMFYEPSTRTSSS
FIAAMERLGGRTVNINTSASSVKKGETLQDTIRTLACYSDAIVLRHPDEMSAHIAAKYSP
VPIINGGNGSREHPTQAFLDLFTIREELGTVNGITVTFMGDLKFGRPVHSLCRLLQHYQV
RINLIAPKELRLPNALRKELQDSGLLGIESETLTPEIISKSDVLYCTRVQQERFETEEDY
LKLKDTYIVDNKILSHAKQQMVVMHPLPRVNEIREEVDYDHRAAYFRQMRYGLFVRMALL
AMVMGVEL
NT seq 6687 nt NT seq  +upstreamnt  +downstreamnt
atgtctattatcactcctactgctcctatcacccctccaatggagtctactggtgatcgt
atgattaccttggaattaaaggatggaactactttacaaggttactcctttggtgccgaa
accactgcagccggtgaattggttttccaaactggtatggtcggttacccagagtccatc
acagatccttcttatgagggtcagattttagttatcactttcccattggttggtaactac
ggtgtccctgaccgtaaattaatggatgaatacgtggaaggattaccacgttattttgaa
tccaacagaattcatgttgctggtttagtcattgctcattacaccgaagaatattctcac
tggttagctcaatcttctttaggtacttggttgaaagagagcaacgttccagctgtctac
ggtattgatagcagaagcttgaccaaacatttaagagaagctggttccatgttgggtaga
ttcgctctacaaaagcccgggacctctttcgaggatgccaactctgctgaatggatgtct
tacttcgaaactccagaatgggttgatccaaatgttgataatttagtggcaaaggtttcc
ctaaaggctcctaagcttttcgttccaaaccacccagacatcgatcttgttcaaggtcct
gacggaaaaactttacgaattgttgccgttgatgtgggtatgaagtacaaccaaatccgt
tgtttcgtcaagcgtggtgttgaattgttggttgttccatgggattacgacttcaccacc
gaagaatatgacggtttgttcatctctaatggtcctggtaatccagccattctgcaggaa
gtgtccgatagattgactaaagttttagatgcgaagaagaccccagtcttcggtatctgt
ttgggtcatcaattactagctcgtgcttctggtgcctcaactttgaagatgaagttcggt
aacagaggtcacaatattccatgtacttcgactgtctctggtagatgttatatcacttct
caaaaccatggtttcgctgtagatgaaactagtttgaccaatggctggaaatcattgttc
accaacgctaacgatggttccaatgaagggatttatcactcagagttgccttacttctcc
gttcaattccatcctgaatctactccaggtccaagagacactgaattcttgttcgatgtc
ttcattcaatctgttctagatttcaagcaaactggtgtattgaagcaagttgaattccca
ggcggtaacattgaggagaacttggctgctcatcctagagaagatgtcaagaaagtttta
gtcttgggttccggtgggttatctattggtcaagctggtgagtttgattattctggttct
caagccatcaaggctttaaaagaagaaggtatctacacgatcttaattaaccctaatatc
gctaccattcaaacctctaagggtctagctgataaagtgtacttcttgcctgttaccgct
gaattcgttaggaaagtaattttacatgaacgcccagatgccatttacgtgacatttggt
ggtcaaactgctttgtcagtcggtattgaaatgaaagatgaattcgaaactttgggtgtc
aaggtcttgggtactccaatcgatactgtcatcaccactgaggatcgtgaactatttgct
aatgccatggacgaaattaatgagaaatgtgctaagtctgctgctgctgccactgttgcg
gaagctctagaggctgtcaaggatatcggattccccgtcattgttcgtgcagcttacgct
ttaggtggtctaggttccgggtttgcttcgaatgaaaaagaattggtcgacttgtgtaac
gttgcctttgcttcttcccctcaagttttggttgaaagatccatgaaaggttggaaagaa
atcgagtacgaagttgttcgtgatgctttcgacaattgtatcactgtctgtaatatggaa
aactttgatcctctaggtattcacactggtgattccattgtcattgcgccatcccaaacc
ctatcagacgaggattacaatatgttaagaactaccgcagttaacgtcattagacatcta
ggtgttgttggtgaatgtaacatccaatatgcattaaatccaacttcaaaagaatactgt
atcattgaagtcaatgctcgtctatctcgttcctctgccctagcttcaaaggccactggt
tacccattagcttataccgcagctaagttgggtttaaacattcctttatacgaagtcaag
aactcggtcactcgttctacctgtgcttgtttcgaaccctctttagattactgtgttgtt
aagatgccaagatgggacttgaagaagttcactcgtgtctcaactctgctttcttcctca
atgaaatctgttggtgaggtcatgagcatcggtagaactttcgaagaggcgattcaaaaa
gctatcagatctactgaatactctaatattggtttcagtgaaactgatgatgaacttgat
atcgactatgagttaagtaatccttctgatatgagaatttttgccattgctaatgcattt
gctaaatttggttattctatcgatcaagtttgggagaaaaccaatattgataaatggttc
ttgaacaaactatatagcttgatcaaattttcagacaagatcagttcttatgggtccaag
gagaacctaccagcgttggttttgaagcaagccaagcaattaggtttcgaagacagacaa
attgctaaatttttgaattcgaatgaagttgctattcgtcgtctaagaaaagaatacggc
attattccatttgtaaagcaaattgatactgttgctgcggaattcccagcacacacaaac
tatttgtatctaacatacaatgcagctgctcacgatttggacttcaatgaccacggtgtt
atggttttgggttcgggtgtttaccgtattggttcttctgttgagttcgattggtgtgct
gttaccgctgttagaactttgcgtaaaaataacttcaaaacaatcatggttaattacaac
cctgaaacagtttctaccgattatgatgaggctgacagactttacttcgaaactattaac
ttagaaagaattatggatatttacgaattggaaagctctgctggtgttgttgtttctatg
ggtggtcaaacttccaacaatattgccatgtctttacaccgtgaaaatgttaagatccta
ggtacttctccagagatgatcgattctgctgaaaaccgttataagttctcacgtatgttg
gatcaaatcgatgttgaccaacctgcttggaaagaattgacttccatggatgaggccgag
gattttgctgaaaaagtaagctatcctgttttagtcagaccttcctacgtcttatcaggt
gccgcaatgaatacagtctattctaaggatgacttggaatcttatttgaaccaggccgtg
gaagtttctcgtgaatatccagttgttatcaccaaatatattgaaaatgctaaggaaatc
gaaatggacgcagttgccttagacggtgaattgattatgcatgtcgtttctgagcatgtt
gaaaacgcaggtgttcactctggtgacgctacactaattgttcctcctcaagatttagac
cctgaaacagttcgtagaatcgttgaagccactgccaaaatcggtagagcattgcagatt
actggtccatataacattcaatttattgctaagaacaacgaaattaaggttattgaatgt
aacgttagagcatctcgttcgttcccattcatctcgaaagttgttggtgttaacttgatt
gaaatggccactaaggccattatgggcattcctgtaaccccttacccagtggagaaactt
cctgatgactacgtagcaatcaaagttcctcaattctctttcccacgtttggctggtgca
gatccagttctcggagttgaaatggcctcaactggtgaagttgctgctttcggccattct
aaatatgaagcttacttgaagtccttgttggcaactggcttcaaattaccaaagaaaaac
attctattatccatcggttcatacaaggaaaaacaagaattgctaccaggagtgaagaag
ttatacaatatgggttacaagttgtttgccactgccggtaccgcagatttcatttctgaa
catggaattccagttcaatacttggaagtattgaacgaagaagacgatgaaaagtccgaa
tattctttgacacaacatctagccaacaacaagattgatttgtatatcaacctaccatct
gctaataggttccgtcgtcctgcatcttatgtttcgaagggttatagaactcgtcgtatg
gctgttgatttttctgttccattagtaacaaacgtcaaatgtgccaaacttttgattgaa
gccctatccagaaatatgtcactagatgtttccgaacgtgatgcccaaacttctcacaga
actgtgaccatccctggtttgataaacatctctgcttatgttccaaatatctctaacgtt
ttgttaggtccagcagagctcaaggaagtaacccgtctttctgttgaatctggtttcact
tactcacagattatgccaaagtcttctagtggaccagttattacggatgctgcttctttg
aaggttgccaactcagttgttaaagactctgcttacacaaactttggtttcactgttgcg
gctactccaaacaatattgacaccgtctccgctgttgctaacgaggctacctctttgttc
ttgccatatcgcgagctttcaaacaacgttccagccgtttctgagcacctaaaacattgg
ccactagataaaccagtgattgctgaagccaagacatctgacttagcttcggtgattttg
ttagcctctttgcagaacagatctattcatattactgctgtttccaacaaagaagatttg
tccttggttatggctgttaaggagaaacaatccaacgttacctgtgatgtcaatattcat
tccttgttcgtttctcaggatgactatccagaagctaaattcctcccaaccaaagaagac
caagaattcttctggtccaacttggaatcaattgatgctttctctatcggttcattacca
actgctcttgctgcggttactggtaacgaaattgttactggtctcggtattaaggaagct
ctaccattgttattgtctgctgttaatgatggaaggttgaccattgatgatatcgttgaa
cgtttgcatatcaatccagctaagattttcagcattcctgagcaaaactccgctgttgaa
gttgatttggacttcacgttcagacataccaaaagatggtctccttatcaaaaaggggga
ttgactggtggtattcaacgtgtgttgatcaatgaagagacaattgttttatctggtgac
ttagtcgctactgaagccaagggccaaccaatcctaccatccaagtttactccaactact
ccggcagtagcaaaggaaactccactggctgcagtcggaactccaattttgggggccatc
tctacatcaagaaagagattctctttctctaatgaaagaaggctatccatcaattctatg
gatggtgatgatgaagaagccatcttggatcaaccattggaacaaagacttatgtcctcc
agaccacctaaagagctctccgctccaagtgttttgatcaatttgatccgcacaaagaat
ccattcttgagaagaaacattctatcagttaaccaattcaagcgttctgatttccatgct
ctcttcgcagttgctcaagagctcagagctggtgttgaaagggaaggtgttttggacgtc
atgaagagccgtgttttgactacaatgttctacgaaccatcaacccgtacatcatcttca
ttcattgctgctatggaacgtttaggtggtagaactgtcaacattaacacttctgcatct
tctgttaagaagggtgaaacattgcaagataccatcagaacattagcctgttactctgat
gcaattgtcttgagacatccagacgaaatgtctgcccacattgctgccaagtactcacct
gttcctatcatcaacggtggtaacggttctcgtgaacatccaactcaagccttcttggat
ctattcactattcgtgaagaattgggtactgtcaacggtatcactgttacctttatgggt
gacttgaagttcggtagaccagttcactccttgtgtcgtttgctacaacattaccaagtt
agaattaacttgatcgctcctaaggaattgaggttgcctaatgccttgcgtaaagaattg
caagattctggcttattaggtattgaaagtgaaacactaacacctgaaatcatttccaaa
tccgatgtgttgtactgtacaagagtgcaacaagaaaggttcgaaaccgaggaagattac
ttgaagctcaaggacacttacattgttgacaataagatcttgtctcatgctaaacaacag
atggtggtcatgcacccactacctcgtgttaatgagattcgtgaagaggttgactacgat
catcgtgcagcttacttcagacaaatgagatatggtttgtttgtcagaatggcattgtta
gccatggttatgggtgttgaattataa

DBGET integrated database retrieval system