KEGG   Kluyveromyces lactis: KLLA0E17337gHelp
Entry
KLLA0E17337g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
kla  Kluyveromyces lactis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(1538169..1538567)
Genome map
AA seq 132 aa AA seqDB search
MAPKAEKKPASKAPAEKKPAAKKTSSSVDPSKKRTKARKETYSSYIYKVLKQTHPDTGIS
QKSMSILNSFVNDIFERIATESSKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGT
RAVTKYSSSTQA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaaagctgaaaagaaacctgcttccaaggctcctgccgaaaagaaacctgct
gccaagaagacttcttcttctgttgatccatcaaagaagagaaccaaggctagaaaggaa
acttactcttcttacatctacaaggttttgaagcaaacccatccagacactggtatttcc
caaaagtctatgtctatcttgaactctttcgttaacgatatctttgaaagaattgctacc
gaatcgtccaagttggctgcttacaacaagaagtctaccatctctgctagagaaattcaa
actgctgttagattgatcttgccaggtgaattggctaagcacgctgtttctgaaggtact
agagctgttaccaagtactcttcctccactcaagcttaa

DBGET integrated database retrieval system