KEGG   Kluyveromyces lactis: KLLA0E19669gHelp
Entry
KLLA0E19669g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
kla  Kluyveromyces lactis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:kla03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1751471..1752304
Genome map
AA seq 277 aa AA seqDB search
MSWDDEDFAVPSGSKEKPVLNSWDDEFAENDDEPVLESWEDEETAKPKPKAAAAAAAKAP
KKASPSPAATPAATKNTMLDIDTLDDKTRKELLRKAELESDLNNAADLFGGLGVAEEHPR
ARAEREREQLAAVAQPAALTKDTPIQSHPLFSDLETKKDYQELRKALATAITSTSNKSLL
NYSGGLAIDLIRDISKPMTVENIRQTIATLNVLMKDKEREERQARLAKVKGGTATGGAGK
KKAKATRANLGGAFKKDNDFDLGGNDNFDDFGEDDFM
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgggacgacgaagattttgcagtgccaagtggctccaaagagaagccagtgttg
aattcatgggatgatgagttcgctgaaaacgacgatgagccggtactagagtcctgggag
gacgaggagactgctaaacctaagcctaaggcagcagcagcagctgcagccaaggctcca
aagaaagcctctccatcaccagctgctacaccagctgctacaaagaacaccatgctcgat
atcgatactcttgacgacaagacccgtaaagaactattgagaaaggctgaactggaatct
gatttgaacaacgctgcagaccttttcggcggtcttggcgtcgcagaagaacatccaaga
gcccgcgccgaacgtgaaagagaacagcttgcagctgtcgcccaacctgctgcgttgacc
aaggataccccaatccaatcgcacccattgttctcggatttggaaaccaaaaaagattac
caagaattaaggaaagcgttggctaccgcaatcacctcgacaagcaacaaatccttgttg
aactactctggtggactagccatcgacttgatcagagacatttccaaaccaatgaccgtc
gaaaacatcagacaaaccattgcgacattgaacgtattgatgaaggataaagaaagagaa
gaaagacaagctcgtttggccaaagtcaagggaggcaccgccacaggcggtgccggtaag
aagaaggccaaggctactagggctaacctcggcggtgccttcaagaaggataacgatttc
gacctaggtggtaacgataactttgacgatttcggagaagacgatttcatgtaa

DBGET integrated database retrieval system