KEGG   Kluyveromyces lactis: KLLA0E19669gHelp
Entry
KLLA0E19669g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
kla  Kluyveromyces lactis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:kla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    KLLA0E19669g
Translation factors [BR:kla03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    KLLA0E19669g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1751471..1752304
Genome map
AA seq 277 aa AA seqDB search
MSWDDEDFAVPSGSKEKPVLNSWDDEFAENDDEPVLESWEDEETAKPKPKAAAAAAAKAP
KKASPSPAATPAATKNTMLDIDTLDDKTRKELLRKAELESDLNNAADLFGGLGVAEEHPR
ARAEREREQLAAVAQPAALTKDTPIQSHPLFSDLETKKDYQELRKALATAITSTSNKSLL
NYSGGLAIDLIRDISKPMTVENIRQTIATLNVLMKDKEREERQARLAKVKGGTATGGAGK
KKAKATRANLGGAFKKDNDFDLGGNDNFDDFGEDDFM
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgggacgacgaagattttgcagtgccaagtggctccaaagagaagccagtgttg
aattcatgggatgatgagttcgctgaaaacgacgatgagccggtactagagtcctgggag
gacgaggagactgctaaacctaagcctaaggcagcagcagcagctgcagccaaggctcca
aagaaagcctctccatcaccagctgctacaccagctgctacaaagaacaccatgctcgat
atcgatactcttgacgacaagacccgtaaagaactattgagaaaggctgaactggaatct
gatttgaacaacgctgcagaccttttcggcggtcttggcgtcgcagaagaacatccaaga
gcccgcgccgaacgtgaaagagaacagcttgcagctgtcgcccaacctgctgcgttgacc
aaggataccccaatccaatcgcacccattgttctcggatttggaaaccaaaaaagattac
caagaattaaggaaagcgttggctaccgcaatcacctcgacaagcaacaaatccttgttg
aactactctggtggactagccatcgacttgatcagagacatttccaaaccaatgaccgtc
gaaaacatcagacaaaccattgcgacattgaacgtattgatgaaggataaagaaagagaa
gaaagacaagctcgtttggccaaagtcaagggaggcaccgccacaggcggtgccggtaag
aagaaggccaaggctactagggctaacctcggcggtgccttcaagaaggataacgatttc
gacctaggtggtaacgataactttgacgatttcggagaagacgatttcatgtaa

DBGET integrated database retrieval system