KEGG   Kluyveromyces lactis: KLLA0E20351gHelp
Entry
KLLA0E20351g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
kla  Kluyveromyces lactis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1810593..1812686
Genome map
AA seq 697 aa AA seqDB search
MSSLKKWLGFQQSSTRKTSSSDKRSSSSSSAELATATPPIIIEPTRNHNGSSLVHNDDSE
RNTEPIAITNGSHDSTSDISHDPLHTEVFEYMPSYTIPNTITADLPFGSGSTKVFGYENF
GNTCYCNSVLQCLYNLTEFRTEILKYPSRDGLLRRRRKSSVVGVKPRVFTEASFTSQPQP
AQHTNKHVNGSGCSPGGHNPAANTDGISSAENSRRGSLKFFKNSSDANTNNALPPSSPGS
SQAKPPPRPVHTVVMPSDPISEKLHENYTKIIVGRTQGTSFQSGNPEVQCSANSLPPSSS
SSSSPNALAVPQPVPHSNSHLKAPSIEQRKKAALVNGPVVNVDTSLADYLPKGTKPTLYS
GLKDIFECIAENESAIGVVSPSNFVNILKQENILFSSSMHQDAHEFLNYLLNELSDTLKR
DMELDTDKLESKPTFIEDLFKGSLCNSTKCFTCDTITARDEPFLDFPIEIQEDEEIKIQD
ILNNYKHRELLTGANKFYCDKCCGLQEAERTVGLKSLPKTLAIHLKRFKYSEARNCNAKL
FNRIHYPLDLRVCSSFDSAVCKDYELNGIVIHMGGGPHHGHYVAICKNDLFGWLLFDDET
VESINEETVLKFIGDANELTTAYVLIYKESSVSSIDSSSFEKNIEQLLKEDEMYRRRYSI
ATNESVLEGVPEEGNNEDSRRHKTKSKLFSFKRNAKA
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcccttaagaaatggttgggatttcaacaaagttcgactcggaagacaagttcg
agcgataaacgcagctctagcagttctagtgccgagctggcaactgctacgcctcctatt
ataattgagccaactcgtaaccataatgggtccagtctggttcacaatgacgattcagaa
cgaaatacggaacccattgctatcaccaatgggagtcacgatagcacaagtgatatcagt
cacgaccccttacacacggaagtatttgaatacatgccatcttatactataccgaatacc
attactgccgacctacccttcgggagtggatcgaccaaggtctttggatatgagaacttc
ggaaacacttgctattgcaattcggttcttcaatgtctctacaatctaaccgagtttagg
acagaaattcttaagtatccttcgagagatggattactcagaaggagacggaaatcaagc
gttgttggcgtgaagcctagagttttcaccgaggcaagtttcacgtcacagcctcaaccc
gcacagcatactaataagcacgtcaatggcagtggttgtagcccaggtggtcacaacccc
gccgccaacacggatgggatttctagtgcagagaatagtagacgtggctccctgaaattt
tttaaaaattcatcggatgcaaatactaataacgcgttacctcccagttctccaggatct
tcgcaggcaaagccaccacctcggccggtacacacagttgtgatgccctctgacccaatt
tccgaaaaattgcatgaaaattataccaagattatagtcggaagaactcagggtacatca
ttccaatcggggaatccggaagtgcaatgcagcgcaaattctttgccaccatcaagttcg
tcttcatcttctcccaatgcactggccgtgcctcagccggtaccacattcaaattcacac
ttaaaagcaccctccattgaacaaaggaaaaaggcggcgctagtcaacggaccggttgta
aacgtcgataccagcttagcggattatctgccgaaaggtacaaaacctacattgtattcg
ggtctaaaagatattttcgaatgtattgctgaaaatgaatcagcaataggtgttgtatct
ccttcgaactttgtcaatatattgaaacaagagaatatcttgtttagttcttcgatgcat
caggacgcacatgaatttttaaattatttattgaacgaattaagtgatactttaaaaaga
gatatggaactggatactgataaacttgaatcaaaaccgacatttatcgaggatctgttc
aaagggtcattatgcaatagtactaaatgttttacttgcgatactatcactgcaagagat
gaaccatttttagattttcctattgagattcaggaagacgaagaaatcaaaattcaagac
attttaaacaactacaaacatcgcgagttattaactggtgccaataaattttactgcgat
aaatgttgtggcttacaagaagctgagcgtactgtgggattgaagtctttaccaaaaact
ttggctattcatttgaaaaggttcaaatattcagaagcacgaaattgtaatgccaaactt
ttcaacagaattcactatccactggatctcagagtatgttcaagctttgatagcgccgta
tgtaaagattacgaactcaacggaatagtcatccacatgggaggaggccctcaccatggg
cattatgttgctatttgcaaaaatgatctattcggttggttgttgtttgatgatgagact
gtagagtccatcaacgaggaaacagttttaaaattcattggtgacgctaacgaactcact
acggcatatgtcctaatctataaggaatcttcagtctctagcatagattcctcgagcttt
gaaaagaacattgagcaattgttaaaagaagatgaaatgtatagaagaagatattccatt
gccaccaatgaaagtgttttagaaggcgttcctgaagaagggaacaatgaggattccagg
cgtcacaaaacaaaatctaaacttttcagtttcaaacggaacgccaaagcataa

DBGET integrated database retrieval system