KEGG   Kluyveromyces lactis: KLLA0E20703gHelp
Entry
KLLA0E20703g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
kla  Kluyveromyces lactis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:kla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    KLLA0E20703g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(1841092..1842207)
Genome map
AA seq 371 aa AA seqDB search
MSFYRTSNSSSSSTPSTMATEKDLANDIVLNNAAEDSISDIAFSPQSDFMFSVSSWDSKV
RIWDVQSGSPQGRAQYDHQAPVLTTRWSIDGTKVASGGCDNVLKVFDVTTGQAQQIGQHN
SAVQSLRFVSCGPTNQECIATGSWDKTVKYWDLRSPQPIMTLQMPERVYCMDASQKLMVV
GMAERHIAVIDLNNPGQIFKTSLSPLKWQTRSISCYNEGNGFAIGSIEGRCAVQYIDEQE
QRKDGFSFKCHRQQVQNNGAAGGRTSTEVQVYPVNSIVFHPIHGTFATAGGDGSFHFWDK
NHRHRLKGFPKLNYSIPVCQFNRTGSVFAYALSYDWHQGHIGNRPDYPNVIRLHATTDEE
VKAKKKTTGTR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtccttttaccgtacaagtaactcatcgtcatcatccacaccgtcaacaatggcaact
gagaaagacttagcaaatgatattgttttaaacaatgcagcagaggattcaattagtgat
attgctttttctccacagtcagacttcatgttcagtgtaagttcatgggatagcaaagtt
agaatatgggatgtccaaagtggatcccctcaaggaagggcacagtacgatcatcaagct
ccagtgttaactacgagatggtcaatcgatggaactaaagttgcaagtggcggctgtgat
aatgtcttaaaagtatttgacgtgactacaggacaagcacagcagatcggacaacacaac
agtgctgtacaatctttaagatttgtatcatgtggaccaaccaatcaagagtgcatcgct
acgggttcttgggataagacagtaaagtactgggatcttaggtctccacagccgataatg
acattacaaatgcccgaaagagtgtactgcatggatgcttcacaaaaacttatggtggta
ggcatggctgaaagacatatagcggtaatagacttgaataatccaggtcaaatctttaag
acatctctatcacctttgaaatggcaaacaaggtctatttcgtgttataatgaggggaac
ggatttgcaattggttctatcgagggaaggtgtgccgttcaatacattgatgaacaagaa
caaaggaaagacggtttttcgttcaaatgccatcgtcaacaagtgcagaataacggtgct
gctggtggtagaacgtctactgaagtccaagtgtaccctgtaaatagcatagtattccac
cctattcatggtacgtttgctactgctggtggggacggttctttccacttctgggataaa
aaccatagacacaggctaaaaggcttcccgaaattaaactactccattcctgtttgccaa
ttcaataggacgggttctgtttttgcctatgcactaagttatgactggcatcaaggccat
ataggaaacaggccagactatccaaacgtcattcgattgcacgcaactaccgacgaagaa
gtcaaggctaagaaaaagactactggaacccgataa

  All links  
No link information was found.   
DBGET integrated database retrieval system