KEGG   Kluyveromyces lactis: KLLA0E20857gHelp
Entry
KLLA0E20857g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
kla  Kluyveromyces lactis
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:kla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    KLLA0E20857g
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    KLLA0E20857g
   04113 Meiosis - yeast
    KLLA0E20857g
Protein phosphatases and associated proteins [BR:kla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     KLLA0E20857g
Ubiquitin system [BR:kla04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     KLLA0E20857g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1860517..1862649
Genome map
AA seq 710 aa AA seqDB search
MLFHSVRQNAGGNVPAHDSLGGHNQEIMDASVFNGLPSATSAADAAATAAAASASNYVDS
SNLSHLSEKFKRLETLISDHLSQLNIESAVFVSELLFAECSNLDESSQERALANYFYSLS
LYLNNDFHTAMHVSSERRHDNLACAYVYSRCCLKLKKNYSDALDCLLSLQSCWDTCLSHF
GYPKKSTICLLVGKLFKLLDHESKSETFLRSSLDGNPYLWEASTELCVLRSSLVLTVFKS
QKNAPTRSQSSAAMMTVPPPNCSMDSRSRNKPQTPFKAPSRNRQNLSNSQTTSLLSASNV
GVSISPHFFKKHTRFTTTPTTATSSANVTTTNTSSIDTKHLGTTTPSKLSGTDSQTKLLR
SPMDKKIMTNNSYQMPNISTFDSNLDELFSNFIHIEYCKSRYDSFKAIRMMQNRIPLQIA
VSMPWCLSTLGKLHFELVNYEMAKSYFTKLRTLQPTRFQDMDTFSTVLWHLQDKTHLSAL
CAELLTLDKYNPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNND
AFDNAKSCFRKALTIEKTHYNALYGLGMCCVKLGKFEEALLFFEKARALNPVNVILNCCC
GVALERLQQPERALNFYELATELQPNSSLALFKKSQLLLNMGQYSSALHNFERLESLTPD
EAHVHFLLGNLYQIVGKKQDAMNQYTIAMNLDPKGSQLIKEAMEKCHEQG
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgctattccattctgtgcggcagaatgctggtggaaatgtgcctgctcatgatagttta
ggtggtcacaatcaagaaattatggatgcatcagtcttcaacggcctgccgtctgcaacc
tccgcagcagatgcagcagcaacagcagcagctgcctctgcttcaaattatgttgattca
tcgaatctctcacatctttcagagaaatttaaaagacttgaaactctaatctcggatcat
ttatcacagttgaacatagaatccgccgttttcgtctcagagttgttatttgcggaatgc
tcgaatctggacgaatcatctcaggaaagagcgcttgcgaattacttttactctctatcc
ctgtacttgaacaatgactttcatactgctatgcatgtttcctctgaaagaagacatgat
aatcttgcatgtgcctacgtatactctcgatgttgtttgaaattgaagaagaattattca
gacgctttggattgtctattatcattacagtcctgttgggacacctgtctatcccatttt
gggtatccgaagaaatcaacaatctgtctcttagtagggaagttattcaaattattggat
cacgaatctaagagtgaaactttcctcagatcttccttggatgggaatccttatctctgg
gaagcgagcacagaactttgtgttcttcgttcaagtttggttcttacggtattcaaatcc
cagaagaatgcgcctacacgctcgcaatcatctgcagcaatgatgacggtaccacctcca
aactgtagtatggattccagatctaggaataagcctcaaactccatttaaagctccatcc
agaaacagacaaaacctttccaactcccaaactacatccttattatcggcttctaacgtt
ggtgtatccatttctcctcatttctttaaaaaacacacaaggtttactacaacaccaact
actgcaacttcaagtgcaaatgtaaccactacaaacacatcttctatcgatactaaacat
ctcggaactacaacaccatcgaaactgtcaggaacagattcccaaaccaagttgttaagg
tctcccatggataaaaaaattatgaccaacaactcatatcagatgccaaacattagcact
tttgactcaaatttggatgaacttttctccaacttcatccatatagaatattgcaagtca
aggtatgattcattcaaagccatccgcatgatgcaaaatcgcattccactacagatagcg
gtgtctatgccttggtgtttatccacattgggtaagctacattttgaattagttaattat
gaaatggctaaatcttacttcacgaaattaagaactttacaacctacgcggtttcaagat
atggacaccttctcaaccgttttatggcatttgcaagacaaaacacacttatccgcttta
tgcgcggagctattaacgttggataagtataaccccattgcctggtgcagcatggggaat
cttcattcgttaaataaagatcacgacgaagccattactgctttcggaaaggcaattcaa
ttggacccattctttgcttacgcttacactttacaagggcacgagtattctaataatgat
gcattcgacaatgcaaaatcttgcttccgtaaagctttaactatcgaaaaaactcattac
aatgcactttacggacttggaatgtgttgtgtcaaacttggaaagtttgaagaagcacta
ttattcttcgagaaggcaagagccttgaatccggtcaatgtcattttgaattgttgctgc
ggcgttgcgttagaaagattacagcagccagagagagctttgaacttctacgaattagca
actgagttacaaccaaactcgtctttagcattgttcaagaaatcacaacttctattgaac
atgggacagtattcttctgcgctacataattttgaaagattagaatcacttacccctgat
gaagctcatgtgcactttttgcttggtaacctgtaccaaattgtgggtaagaagcaagat
gcaatgaatcaatatactattgcaatgaacctagaccctaaaggtagtcaattaataaaa
gaagccatggaaaaatgtcatgaacagggttga

DBGET integrated database retrieval system