KEGG   Kluyveromyces lactis: KLLA0E23937gHelp
Entry
KLLA0E23937g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     KLLA0E23937g
Transfer RNA biogenesis [BR:kla03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    KLLA0E23937g
Chromosome and associated proteins [BR:kla03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    KLLA0E23937g
   HAT complexes
    Elongator complex
     KLLA0E23937g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 2894353
NCBI-ProteinID: XP_455030
UniProt: Q6CM09
Position
E:2131460..2133145
Genome map
AA seq 561 aa AA seqDB search
MGRKGKGPKNNKQKLAPEKERFLQCCSDITIELISSLTGGSSKEVNLNGLITRYSKRYKL
KQQPRLTDIINSIPDQHKKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVY
CPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRIEQLKQLGHSIDKVEYIIMG
GTFMSLPKDYREDFIVKLHNALSGFNGNDIDEAIQYSQQSLTKCVGITIETRPDYCTQTH
LDDMLKYGCTRLEIGVQSLYEDVARDTNRGHTVQSVCETFAVAKDAGYKIVSHMMPDLPN
VGMERDIEQFKEYFENPAFRTDGLKIYPTLVIRGTGLYELWKTGRYKSYNANALVDLVAR
IMALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDFGTTSRDVRTREVGIQEV
HHKVQPDQVELIRRDYYANGGWETFLSYEDPKQDILIGLLRLRKASKKYTYRKEFTSQRT
SIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAEKIAREEHGSEKISVISGVGVRNY
YAKLGYELDGPYMSKRLYQEC
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgcaaaggtaagggtccaaagaataataaacaaaagctagctccagagaaggaa
cggttcttgcaatgttgttccgatattactattgagttgatcagttctttaactggtggt
tccagcaaggaggtcaatttgaatggattgattacaaggtactctaaaaggtacaagttg
aagcaacaaccaaggttgacggatattatcaactctattccagatcagcataagaaatat
ttattacccaagcttaaggctaaacctgtgaggacggcttctggtattgctgttgtggct
gttatgtgtaaaccacaccgttgtcctcatattgcatacactggtaacatttgtgtttat
tgtccaggtggtccagattcagatttcgaatattcgacacagtcgtacacggggtatgaa
ccaacatctatgcgtgctattcgtgctcgttatgatccatacgaacaagctcgtggtaga
atagagcagttgaaacagttgggtcattctatagacaaggttgagtatattatcatgggt
ggtactttcatgtccttgcctaaggattacagagaagatttcattgtcaaattgcataat
gcgttgtccggcttcaatggtaatgatatagatgaagctattcaatactctcaacagtct
ttgactaaatgtgtcggtatcactatcgaaactagacctgactactgtacacagacccac
ttggatgatatgttgaaatatggttgtacgagattggaaattggtgttcaatctctatat
gaagacgtagccagagataccaatagaggtcatactgttcaatcggtttgcgaaacattt
gcggtcgctaaagatgccggttacaagattgtttcacacatgatgcctgatttaccaaat
gtggggatggaaagagatatagaacaattcaaagaatactttgaaaatcctgcttttaga
acagatgggttgaaaatctatccaactttggtcatcagaggtaccggtctatacgaactt
tggaaaactggtagatacaagtcgtataacgcgaatgctctcgtggatctagtcgcacgt
atcatggcacttgttccaccttggacaagaatttatcgtgtgcaaagagatatccctatg
ccacttgttacatctggtgtcgataatggtaacctaagggaattagcattagcaagaatg
aaggattttggtaccacatcaagagatgtccgtaccagggaagtcggtattcaagaagtt
caccataaagttcaacctgatcaagttgaacttattcgaagagattattatgccaatggt
ggctgggaaactttcctatcttatgaagatccaaaacaagatattttgattggtttattg
agattaagaaaggcttcaaagaaatacacatatcgtaaggaatttacttcacaaaggact
tctattgtcagagaattgcacgtgtatggttctgttgttccgctacattcaagagatcca
aggaagttccaacatcaagggttcggtacgttattaatggaagaggctgaaaagattgct
agggaagaacatggatctgaaaagatttctgttatctctggtgttggtgtcagaaactat
tacgcaaagcttggatatgaactggatggtccgtacatgtctaaaaggctatatcaggag
tgttaa

DBGET integrated database retrieval system