KEGG   Kluyveromyces lactis: KLLA0E23937gHelp
Entry
KLLA0E23937g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     KLLA0E23937g
Transfer RNA biogenesis [BR:kla03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    KLLA0E23937g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:2131460..2133145
Genome map
AA seq 561 aa AA seqDB search
MGRKGKGPKNNKQKLAPEKERFLQCCSDITIELISSLTGGSSKEVNLNGLITRYSKRYKL
KQQPRLTDIINSIPDQHKKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVY
CPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRIEQLKQLGHSIDKVEYIIMG
GTFMSLPKDYREDFIVKLHNALSGFNGNDIDEAIQYSQQSLTKCVGITIETRPDYCTQTH
LDDMLKYGCTRLEIGVQSLYEDVARDTNRGHTVQSVCETFAVAKDAGYKIVSHMMPDLPN
VGMERDIEQFKEYFENPAFRTDGLKIYPTLVIRGTGLYELWKTGRYKSYNANALVDLVAR
IMALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDFGTTSRDVRTREVGIQEV
HHKVQPDQVELIRRDYYANGGWETFLSYEDPKQDILIGLLRLRKASKKYTYRKEFTSQRT
SIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAEKIAREEHGSEKISVISGVGVRNY
YAKLGYELDGPYMSKRLYQEC
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgcaaaggtaagggtccaaagaataataaacaaaagctagctccagagaaggaa
cggttcttgcaatgttgttccgatattactattgagttgatcagttctttaactggtggt
tccagcaaggaggtcaatttgaatggattgattacaaggtactctaaaaggtacaagttg
aagcaacaaccaaggttgacggatattatcaactctattccagatcagcataagaaatat
ttattacccaagcttaaggctaaacctgtgaggacggcttctggtattgctgttgtggct
gttatgtgtaaaccacaccgttgtcctcatattgcatacactggtaacatttgtgtttat
tgtccaggtggtccagattcagatttcgaatattcgacacagtcgtacacggggtatgaa
ccaacatctatgcgtgctattcgtgctcgttatgatccatacgaacaagctcgtggtaga
atagagcagttgaaacagttgggtcattctatagacaaggttgagtatattatcatgggt
ggtactttcatgtccttgcctaaggattacagagaagatttcattgtcaaattgcataat
gcgttgtccggcttcaatggtaatgatatagatgaagctattcaatactctcaacagtct
ttgactaaatgtgtcggtatcactatcgaaactagacctgactactgtacacagacccac
ttggatgatatgttgaaatatggttgtacgagattggaaattggtgttcaatctctatat
gaagacgtagccagagataccaatagaggtcatactgttcaatcggtttgcgaaacattt
gcggtcgctaaagatgccggttacaagattgtttcacacatgatgcctgatttaccaaat
gtggggatggaaagagatatagaacaattcaaagaatactttgaaaatcctgcttttaga
acagatgggttgaaaatctatccaactttggtcatcagaggtaccggtctatacgaactt
tggaaaactggtagatacaagtcgtataacgcgaatgctctcgtggatctagtcgcacgt
atcatggcacttgttccaccttggacaagaatttatcgtgtgcaaagagatatccctatg
ccacttgttacatctggtgtcgataatggtaacctaagggaattagcattagcaagaatg
aaggattttggtaccacatcaagagatgtccgtaccagggaagtcggtattcaagaagtt
caccataaagttcaacctgatcaagttgaacttattcgaagagattattatgccaatggt
ggctgggaaactttcctatcttatgaagatccaaaacaagatattttgattggtttattg
agattaagaaaggcttcaaagaaatacacatatcgtaaggaatttacttcacaaaggact
tctattgtcagagaattgcacgtgtatggttctgttgttccgctacattcaagagatcca
aggaagttccaacatcaagggttcggtacgttattaatggaagaggctgaaaagattgct
agggaagaacatggatctgaaaagatttctgttatctctggtgttggtgtcagaaactat
tacgcaaagcttggatatgaactggatggtccgtacatgtctaaaaggctatatcaggag
tgttaa

DBGET integrated database retrieval system