KEGG   Kluyveromyces lactis: KLLA0F00704gHelp
Entry
KLLA0F00704g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
kla  Kluyveromyces lactis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KLLA0F00704g
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KLLA0F00704g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KLLA0F00704g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(60425..61384)
Genome map
AA seq 319 aa AA seqDB search
MSSDPRFDFFQQKKLGIVLAPFSGGQPKSGVENGPKYLMKQGLRSDIESLGWETTLEEPL
KGRDFESGKNDETDVYGIMKRPNLVGEATKLIYESVKKVSNEGRLAVTLGGDHSIAIGTV
AGVLDKYPNAGLLWIDAHADINTCSTTESGNIHGCPVSFLMGLDAKNTPPSLKWVPKCLD
PKKIAYIGLRDVDAAERKILKDNGIASYSMYHVDRYGLNKVIEMALEKVAPNGDEPIMVS
YDVDAIDPLYVPATGTPVRGGLTLREGLFLVERIAETGRLVALDVVECNPELASHDGHVV
DTITTGCSIARCALGETLL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgatccacgttttgatttcttccaacaaaagaagcttggtattgttctagct
ccattctctggtggtcaaccaaaatctggtgttgaaaatggtcctaaatacttaatgaaa
caaggtttgagatcagatatcgaatctctaggttgggaaactactcttgaagaacctcta
aaaggtagagatttcgaatctggtaagaatgatgaaactgatgtttatggaatcatgaaa
agaccaaatttggttggagaagccacaaaactaatctacgaatccgttaagaaggtttcc
aacgaaggcagattggcagtgaccctaggtggtgatcactcgatcgctatcggtaccgtg
gctggcgtcttggacaaatacccaaatgctggtttgttatggattgacgctcatgctgat
atcaacacatgttctactactgaatccggtaacattcacggttgtcctgtctccttcttg
atgggccttgatgctaaaaacactcctccatccttaaaatgggttccaaaatgtttggat
ccaaagaagatcgcctacatcggtctaagagacgtcgatgccgctgaaagaaagattttg
aaggataacggtattgcctcatactccatgtatcacgtagacagatatggtttgaacaaa
gtcatcgaaatggctttggaaaaagttgcaccaaacggtgatgaaccaatcatggtttcc
tacgatgtcgatgctatcgatccattatacgtaccagccactggtactccagtaagaggt
gggttgactttaagagaagggctgttcttggtagagagaatcgctgaaactggtaggcta
gtagcccttgatgtcgtagaatgcaacccggaactggcttctcacgatggtcacgtggta
gatactatcacaactggttgttccattgcaagatgtgctcttggtgaaactctactataa

DBGET integrated database retrieval system