KEGG   Kluyveromyces lactis: KLLA0F00704gHelp
Entry
KLLA0F00704g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
kla  Kluyveromyces lactis
Pathway
kla00220  Arginine biosynthesis
kla00330  Arginine and proline metabolism
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
kla01130  Biosynthesis of antibiotics
kla01230  Biosynthesis of amino acids
Module
kla_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    KLLA0F00704g
   00330 Arginine and proline metabolism
    KLLA0F00704g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KLLA0F00704g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 2895828
NCBI-ProteinID: XP_455111
UniProt: Q6CLS8
Position
F:complement(60425..61384)
Genome map
AA seq 319 aa AA seqDB search
MSSDPRFDFFQQKKLGIVLAPFSGGQPKSGVENGPKYLMKQGLRSDIESLGWETTLEEPL
KGRDFESGKNDETDVYGIMKRPNLVGEATKLIYESVKKVSNEGRLAVTLGGDHSIAIGTV
AGVLDKYPNAGLLWIDAHADINTCSTTESGNIHGCPVSFLMGLDAKNTPPSLKWVPKCLD
PKKIAYIGLRDVDAAERKILKDNGIASYSMYHVDRYGLNKVIEMALEKVAPNGDEPIMVS
YDVDAIDPLYVPATGTPVRGGLTLREGLFLVERIAETGRLVALDVVECNPELASHDGHVV
DTITTGCSIARCALGETLL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgatccacgttttgatttcttccaacaaaagaagcttggtattgttctagct
ccattctctggtggtcaaccaaaatctggtgttgaaaatggtcctaaatacttaatgaaa
caaggtttgagatcagatatcgaatctctaggttgggaaactactcttgaagaacctcta
aaaggtagagatttcgaatctggtaagaatgatgaaactgatgtttatggaatcatgaaa
agaccaaatttggttggagaagccacaaaactaatctacgaatccgttaagaaggtttcc
aacgaaggcagattggcagtgaccctaggtggtgatcactcgatcgctatcggtaccgtg
gctggcgtcttggacaaatacccaaatgctggtttgttatggattgacgctcatgctgat
atcaacacatgttctactactgaatccggtaacattcacggttgtcctgtctccttcttg
atgggccttgatgctaaaaacactcctccatccttaaaatgggttccaaaatgtttggat
ccaaagaagatcgcctacatcggtctaagagacgtcgatgccgctgaaagaaagattttg
aaggataacggtattgcctcatactccatgtatcacgtagacagatatggtttgaacaaa
gtcatcgaaatggctttggaaaaagttgcaccaaacggtgatgaaccaatcatggtttcc
tacgatgtcgatgctatcgatccattatacgtaccagccactggtactccagtaagaggt
gggttgactttaagagaagggctgttcttggtagagagaatcgctgaaactggtaggcta
gtagcccttgatgtcgtagaatgcaacccggaactggcttctcacgatggtcacgtggta
gatactatcacaactggttgttccattgcaagatgtgctcttggtgaaactctactataa

DBGET integrated database retrieval system