KEGG   Kluyveromyces lactis: KLLA0F00858gHelp
Entry
KLLA0F00858g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     KLLA0F00858g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(78519..80666)
Genome map
AA seq 715 aa AA seqDB search
MSQDPLHNFKVQFEKFVASNPNVSSVTSSASRIPESSKAVIVLSPYSLSHQFPRYWVSKS
YKKTIVERPERLLACCIGVSAAITMYPALFSVKTSNHHKTSLLAPHVLKVHGKDWPRELL
KLCKESEKKIDNEEVEVPPDWNVGDIYLSKHTIAALEGSIGALEIGVDSIFQGVSVEQTA
NRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKYDVTHAVILDFDLHHGDGTQDI
CWKRAGFRPDEFSTDAEHGASEDDNKYDEFGKSFAEFPKVGYFSLHDINSFPTELGYATK
ENIRNASTCIMDAHDINIWNVHLQSYKDEEEFVKLYQTKYRSIFAKADEFFKNAKLEMKQ
GGFRFKGLVVISAGFDASEYEQQSMQRHNVNVPTSFYNLFTKDALKLAQMHSNGKIISVM
EGGYSDGAIASGVFSHLIGFQNQNWISEWGSEQVVKEIIRGCKPRWKPYKTKKARDVIRI
WAEEVIMLGRSMIPEFEKVLFDTEDTVTHPEVRLTRSKYHETIVKHENEIPRTETPTPVR
REKPSEQPKDENVPFVDQILPSDEENEEDEDYIYDEELNKTFNRTVEDITIDDISRHLET
LDIIQAKEDEEEQEQEHHGDNGQSHRARTRVPVNSHQRNSRNVSESSNSSSTQETGSNVG
GYKIPSNTTTRHLRSNRHSRLLNFDDSDISMISHGSPPRPKTRSSSSKNGGSNRW
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagatccgttacataattttaaggttcagttcgaaaaatttgtggctagcaac
cctaatgtttcttccgtgacatcttctgcctcgaggatccctgaatcatctaaagccgta
atagttttatcaccatattctttatcacatcagttcccccgttattgggtatccaagtca
tacaaaaaaactattgtagaaagaccagagagattattagcatgttgtattggggtatct
gcagccattacgatgtatccggctttgttttctgtgaagacatcaaatcaccacaagact
tcgttattagcacctcatgtgttgaaagttcatgggaaagattggccgcgagaacttttg
aagctctgtaaagagtctgagaaaaaaattgataacgaagaagtagaggtaccccctgat
tggaatgtcggtgatatttatctttccaaacataccatagcagcgttggagggttctatc
ggagctttagaaattggtgtggattcgattttccaaggtgtgagtgttgagcagacagca
aatagagcatttatcgccattaggccaccaggacatcattctcatgcatccactccctct
ggattctgtctattaaacaacgcacatatcgcaatcgaatacgcttttgaaaaatacgat
gtcactcatgctgtaattcttgattttgatttacatcatggtgatggtactcaagacatt
tgttggaaacgtgcaggatttagaccagacgaattttccacagatgcagaacacggagca
tctgaagatgataacaagtacgatgaatttggaaaatccttcgctgagtttccgaaagta
ggttatttctccttgcatgatatcaactctttccccactgaacttggttatgccaccaaa
gaaaatattcgaaacgcatcaacgtgtatcatggatgcgcatgatatcaatatatggaat
gttcatctacagtcgtataaagacgaagaagagtttgtcaaactttatcagaccaaatac
agatctatctttgccaaggctgatgagtttttcaagaacgcaaaacttgaaatgaagcaa
ggtgggtttaggttcaaaggtcttgtcgtcatcagtgctggatttgatgccagtgaatac
gaacaacaatctatgcaaaggcacaatgtcaatgtcccaacaagcttctacaatctattt
acgaaggatgctttaaaactggcccaaatgcattctaacggtaagatcatttcagtcatg
gaaggtggttattcggacggtgccattgcatctggtgtcttttcacacttgattgggttc
caaaatcagaattggatcagcgagtggggttctgaacaagttgttaaggagattatcaga
ggttgtaaaccaagatggaagccatacaagacaaagaaagctcgggacgtaataaggatc
tgggctgaagaggtcatcatgcttggccgcagtatgattccagaattcgagaaagtgtta
ttcgatacagaggatactgtcactcacccagaagtcagactgaccagatccaagtaccat
gagacgattgtcaagcatgagaatgagatcccaagaacagagactcctactcctgtgcgc
agagaaaagccttcagaacaaccaaaggatgaaaacgtaccgtttgttgatcagatactg
cccagcgatgaagagaacgaggaagacgaagattatatttacgatgaggaattgaacaag
acgttcaatagaaccgtagaagacattacaattgacgatatctcgagacatttggaaacg
ttagacattatacaagcgaaagaagacgaagaggaacaggagcaagaacatcatggcgac
aacggtcaaagtcatcgtgcacgtaccagagttcccgtcaacagccatcagagaaacagc
agaaacgtctctgaatccagcaattcctcctcgacgcaggaaacgggatccaacgtaggc
gggtacaagattccgtcaaacacaacaacacgtcatttgcgcagcaatagacactcaagg
ttactgaactttgacgatagcgatatatcaatgatatcccatgggtctccgccacgccca
aagaccaggtcatcgtcctcgaagaacgggggctccaacaggtggtaa

DBGET integrated database retrieval system