KEGG   Kluyveromyces lactis: KLLA0F01056gHelp
Entry
KLLA0F01056g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
kla  Kluyveromyces lactis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:kla00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    KLLA0F01056g
  Replication and repair
   03420 Nucleotide excision repair
    KLLA0F01056g
Transcription machinery [BR:kla03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     KLLA0F01056g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(96166..97656)
Genome map
AA seq 496 aa AA seqDB search
MSLNLFKTTVNDYLEGLPEQVQSRLYESPATCLAIYRLLSPMAKFFIMSMLFQDHDVSLR
DLDKWVKPDAKYQLQYSIKSMKSLNLIIEGESKQPLLIRLNPIFKKSFKNVLTGGEINNS
FGDVADDDTNPVSTATLDQYSAEKWETILHYMVGTPNTNTPGGKVLDLLQHSGLMEEAEY
GELKITNQGFQFLLQDVNAQMWTLLLQYLKMAESLQMDPVDVLNFIFMLGALQLGKAYKC
DQLSNTQRTMLQDMRDYGLIYQNQSDYAKFYPTRLATLLTSDTKAFRSASVALDSVLNKA
NETTAVEGDSGQDETTERTQDGALIIETNFKLYSYSNSPLQIAILSLFVHLKSRFANMVT
GQLTRESVRNALLNGITAEQIIAYLETHAHPRMRRLAEENLSKKLELDPTVKETLQVLPP
TVVDQIRLWQLELDRIISYDGYLYTDFESYQEYQTVADYAKDIGVLLWQNEKKKMFFVST
EGNSQVLDFHRRNFDK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgaatcttttcaagaccaccgttaatgactacctagaaggtcttccagagcaa
gtccaatcaagattatatgagtctccagcgacatgtttggcaatttatagattgctttct
cccatggcaaaattcttcattatgtcgatgctgtttcaggaccacgatgtctcgcttaga
gatttagataaatgggtcaagccagatgcgaaataccagttacaatactctattaaatcg
atgaaatccttgaatcttataatagaaggtgagagtaaacaacctctattgattcgtttg
aatccaattttcaagaaatctttcaaaaatgtattaactggtggtgaaatcaataactct
tttggtgatgttgcggatgatgataccaatcccgtatctacagctactttggaccagtat
agtgcagaaaagtgggaaacaatcttgcattacatggtgggaacaccgaatacaaacact
cctggtggaaaggttctagacttattgcagcatagtggtctaatggaagaggcagaatat
ggcgaactcaaaattactaaccaaggtttccaatttctcttgcaagatgtcaatgcacag
atgtggactcttcttcttcaatatttgaagatggcagaaagtttacagatggatcccgtg
gatgttctaaatttcattttcatgctaggtgcattacagctagggaaggcgtataagtgc
gatcaactaagtaatacgcagagaacaatgttacaggatatgagagattacggattaatc
tatcaaaatcaatcggattatgcaaagttttatcctaccagattagccacgttgttgacg
tccgacacaaaagcattcagaagtgcctcagtcgctctagacagcgtgttaaataaagct
aatgaaacaacagctgtagaaggagacagtggacaagatgaaactacagagcgaactcaa
gacggtgccttgattatagagactaacttcaaactatattcatattctaactccccattg
caaattgctattctatcgctatttgtccatctaaaatcaagatttgcgaatatggtgact
ggacagcttacgagagaatctgtaagaaatgctttattgaatggtattactgcagaacaa
attatagcataccttgaaactcatgctcacccgagaatgaggcgattggcagaagagaat
ttgagtaaaaaattagagttagaccccaccgtgaaggagacccttcaggttttacctcca
accgttgttgaccaaatacgattgtggcaacttgagttggatagaatcataagttacgat
ggatatctatacacagatttcgagtcctaccaagaataccaaactgtagcagattatgca
aaggatattggtgtactactctggcaaaacgagaagaagaagatgttctttgtgtcaact
gaaggcaattcacaggtgctagacttccacagaagaaattttgataagtag

DBGET integrated database retrieval system