KEGG   Kluyveromyces lactis: KLLA0F03817gHelp
Entry
KLLA0F03817g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K03844  alpha-1,2-mannosyltransferase [EC:2.4.1.131]
Organism
kla  Kluyveromyces lactis
Pathway
kla00510  N-Glycan biosynthesis
kla00513  Various types of N-glycan biosynthesis
kla01100  Metabolic pathways
Module
kla_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    KLLA0F03817g
   00513 Various types of N-glycan biosynthesis
    KLLA0F03817g
Enzymes [BR:kla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.131  GDP-Man:Man3GlcNAc2-PP-dolichol alpha-1,2-mannosyltransferase
     KLLA0F03817g
Glycosyltransferases [BR:kla01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   KLLA0F03817g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALG11_N Glycos_transf_1 Glyco_trans_1_4 DUF2220
Motif
Other DBs
NCBI-GeneID: 2895341
NCBI-ProteinID: XP_455253
UniProt: Q6CLD6
Position
F:362093..363805
Genome map
AA seq 570 aa AA seqDB search
MKLADFVTYVFGSLLAGLVTLKVLSSFIPSLLVTLPAKVRLRVNNSLLKCSNNLNRIPVL
DFGWKNSSVRRAFILASERPSDYTNKIYGDRVHIAYNDRIKRESFVNKLGFDSKRKLLGF
FHPYCNAGGGGEKVLWKAVETSLNQDKNNICVIYTGDTDVNGSDILNSVRRRFEYDLDSD
RIVFIFLQKRRLVESKSWPKFTLLGQAYGSIILSIEALTTLAPDYWIDTMGYPFAYPFVS
LFARIPIVTYTHYPVISTDMLQKLKTMPGFHTNFKLIGKYVYWKIFMLAYKFSGLFVEIA
STNSTWTYNHIKSIWSSTKNIHIIYPPCSTESLIEGCDKSDPVKRLNQAVVIAQFRPEKR
HELILSSFSSFIDATTKKDLIPKIIFIGSTRNVEDREYVETLKKYAFEALKIPTHLVDFK
TDCKYDDMKSILYSSWFGINAMWNEHFGIAVVEYMASGLIPLCHASAGPLYDIVVPWDSK
KNEQSTDKANETGFFFIDETDPDFLAKDSSKYSSLRTLFAQVSKLNTVQRIDISNRAKMC
SLSKFSDSEFERSWNEVLEELNLTHNRMFS
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggctgattttgtcacgtacgtgttcggcagcttactcgcaggattggttaca
ttgaaagtattgtcatccttcataccaagtttgctagtaactctaccagcgaaagtaagg
ttacgtgttaataactcacttctaaaatgctcaaacaatttgaacaggattcctgtgctg
gattttggttggaagaactcctctgttagaagagcctttattttagcttctgaaaggcca
tcggattatacaaacaaaatatatggcgatagggttcatatagcatacaatgatagaata
aagagagagtcattcgttaataagttgggttttgattcaaagcgtaaactcttagggttt
ttccatccttactgtaacgctggtggtggtggagagaaagtcttgtggaaagccgttgag
acatcgctaaatcaggataaaaacaatatatgcgttatctataccggagacacagatgtt
aatggatcagatatattgaacagtgtgcggagaaggtttgaatacgatctagattcggac
agaatagtattcattttcctacagaagagaagactggtagaatcaaaaagttggccgaaa
tttacgctattaggccaagcttatggttccatcattttgtccattgaagcgcttactaca
cttgctccagattattggatagatacaatgggatatccttttgcttatccctttgtatct
ttgtttgctaggattccaattgtaacgtatacccattatcctgtcatctcaacagatatg
ctacaaaagctaaaaactatgccaggatttcacacaaactttaaactgatcggtaaatat
gtctactggaaaatattcatgctcgcatacaaattttcaggcttatttgttgaaattgca
tcgactaattcaacttggacttataatcatattaaatccatctggtcctcaacaaaaaat
attcacattatttatccaccatgttccacagaatcattgatagaaggctgtgacaaatca
gatccagttaaaagactaaatcaagcggttgttattgcgcagtttagaccagaaaaaaga
cacgaattgatattatcttccttctcttctttcatcgatgctacgactaagaaagatttg
attcctaaaataatatttataggatcaacaagaaacgtagaggatagggaatatgttgaa
acgctgaagaagtatgcctttgaggcacttaaaattccaacccatttagtggatttcaaa
actgattgtaaatatgatgatatgaagagtatattatattcttcatggtttggtataaac
gcaatgtggaatgagcattttggtatagctgtcgtggaatatatggcaagtggtttgatc
ccattatgtcatgcttctgctggacctctttatgatattgtagtgccatgggattcaaag
aagaatgaacaaagtactgacaaagctaatgaaaccggctttttcttcatcgatgaaact
gatccggattttctagccaaagattcttcaaagtatagttctttacgcacgttatttgct
caggtatcgaaattgaatactgtacaaagaattgatatctcaaatagagccaagatgtgc
tctttatcaaaattttctgattcagagtttgaacgttcatggaacgaggtgttggaggaa
ctcaatttgactcataatagaatgttcagttga

DBGET integrated database retrieval system