KEGG   Kluyveromyces lactis: KLLA0F04059gHelp
Entry
KLLA0F04059g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
kla  Kluyveromyces lactis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kla00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:385832..387541
Genome map
AA seq 569 aa AA seqDB search
MNNPNTMLSKSSRKPRIPKHSHYFLSFVCISSLLAYYFLLSPFQAGNHNANHSIECPLSR
SSPLIEVSDFNRISEFKLQPIPVSKNISRNDFNKWLEEQTEISFYHMFENICHAETSDKF
DNCTPGVVFASPSKNKPDYFYHWIRDGAITINTLINTYLDIDRERTLETVLDYVNASLDL
QHKSNPSGPADDPLFRNLGEPKYHVDNSAYELVWGRPQNDGPPLRAIALLNFLNQVDDGE
TEKYNWIFDEVIALDLKFVLYNWHIPTYDLWEEVRAYHFFTSMVQLKALVEGKRYLLTSE
AKGVKLSKQLTILLKDIETCIDKIEDFIIDANSGFINHEKGYIVETPSILDERSGLDIAV
IMASTLTHDDSIKDMNTVYDSFLFDIDDPFILNHFNELIERMAVLYPINHNRLNTNMGVA
IGRYPEDIYDGIDISEGNPWFISTLTSAELIYKLVNKMYHDEKPLLIDPISNKFWTKFFE
FGNMKDSLILIPYNTLAFNQTLYTIFKYGDSFLSKVNEHVSNDGSMSEQFNKYHGYNQGA
PNLTWSYGTFSNALRWREIVDRFIHPIAI
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaataaccctaatacgatgctaagtaaaagctcaagaaaaccgagaatacctaagcac
tcacattattttctgtccttcgtttgcatttcttcgttattagcatactatttcctttta
tcaccatttcaagctgggaatcacaatgcgaatcacagtatagagtgccctttatcaagg
tcatctccactaattgaagtgtcagatttcaataggatatctgaattcaaattgcaacca
atcccagtctcgaagaacatttcaaggaatgatttcaataaatggttggaagaacaaacg
gagatttccttctatcatatgttcgaaaacatttgtcatgcagaaacatcagataaattt
gataattgtactcctggtgttgtctttgcgtctccttccaagaacaaaccagattatttc
tatcattggattagagatggtgccatcaccataaacactttaattaatacgtatcttgat
attgatagggaacggactcttgagacagtcttggattacgtgaacgcatctttggattta
caacataaatctaatcccagtgggccagctgatgatcctttgttcagaaatttgggagaa
ccaaaatatcatgttgataacagcgcttatgaacttgtctggggcagaccacagaatgat
ggcccaccattaagagctattgcattgttgaacttcttgaaccaggtagacgatggggaa
accgagaaatacaattggatatttgatgaggtaattgccttagatttgaagtttgtgtta
tataattggcatattccaacgtatgacctatgggaagaagtgcgtgcttatcattttttt
actagtatggttcaattgaaggcgctagtagaaggtaagagatatcttttaacgtcggaa
gcaaaaggtgtaaaattgagcaagcagttgactatactattgaaggatattgagacttgt
atagacaaaattgaggattttatcatcgatgccaattcagggtttataaatcatgaaaag
ggttacattgtggaaacccccagtattttggatgaaaggtcaggtttagacattgctgtg
atcatggcaagcaccttgacacatgatgattctataaaagatatgaacaccgtttatgat
tccttcttgtttgatattgatgatcctttcatattgaatcatttcaatgaactaattgag
agaatggcagtactttacccgatcaatcacaacagacttaatacaaacatgggagttgcc
attgggagatatccagaggatatttatgatggaattgacatctctgaaggtaatccctgg
tttatctcaacgttaacctctgccgaattgatttacaaattagtcaataaaatgtatcac
gatgagaaacctttactcattgatccgatatcgaacaagttctggactaaattcttcgaa
tttgggaatatgaaggattcgctgatcttgataccatataatacattagcgttcaaccaa
acgttgtacacaatattcaaatacggtgattcattcctaagcaaagttaacgagcatgta
agtaacgacggatcgatgagcgaacagttcaacaaatatcatggatacaaccaaggggct
ccaaatttgacatggtcttacggtactttcagcaatgcacttcgctggagggaaattgtc
gatcgattcatccatcctattgccatataa

DBGET integrated database retrieval system