KEGG   Kluyveromyces lactis: KLLA0F04741gHelp
Entry
KLLA0F04741g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kla  Kluyveromyces lactis
Pathway
kla00010  Glycolysis / Gluconeogenesis
kla00020  Citrate cycle (TCA cycle)
kla00620  Pyruvate metabolism
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
kla01130  Biosynthesis of antibiotics
kla01200  Carbon metabolism
Module
kla_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLLA0F04741g
   00020 Citrate cycle (TCA cycle)
    KLLA0F04741g
   00620 Pyruvate metabolism
    KLLA0F04741g
Enzymes [BR:kla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KLLA0F04741g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF3614
Motif
Other DBs
NCBI-GeneID: 2895917
NCBI-ProteinID: XP_455294
UniProt: Q6CL95
Position
F:complement(463107..464528)
Genome map
AA seq 473 aa AA seqDB search
MSALLSRVAPRMSVLACAARLQLRTYASYPPYTIIGMPALSPTMVQGGLTEWSKNVGDRL
EPGDVLAEVETDKAQMDFEFQEEGYLAKILVPAGTKDIPVNKPLAVYVEEESDVPAFANF
TAADAESATAAKEAAKNGAKQPAKEESKEESKEGAKPASKPAAKKSSGSSASSGTRIFAS
PLAKSIALEHGVSLKEVEGTGPRGRITKDDVEAFLASAPSRESSAAKAAPALAAPTPASA
TYEDVPISNMRQIIGDRLLQSTQNIPSYIVSSQISVSKLLKLRQSLNATAKDQYKLSIND
ILIKAIAVAAQRCPDANAYWMPEQGVIRKFKNVDVSVAVATPTGLLTPIVKNAESKGLVS
ISKEIKDLGKRAKDNKLKPEEFQGGTICISNLGMNPAVSMFTSIINPPQSTILAIGTVNK
VPVEDAGSEFGFTFDQKMNITGTFDHRTIDGAKGGEFMKELKKVIENPLELLL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcattactttctagagttgctccaagaatgagcgtcttggcttgtgctgccaga
cttcaattgagaacgtatgcttcttacccaccatacaccatcattggtatgccagctttg
tctcctaccatggttcaaggtggtttgacggaatggagtaagaacgttggtgacaggttg
gagcctggtgatgtccttgctgaagttgaaactgataaggctcaaatggatttcgaattc
caagaagaaggttatttggctaagatcttggttccagctggtaccaaggatatcccagtg
aacaagccacttgctgtttacgttgaggaagaatctgacgttccagctttcgctaatttc
actgctgcagacgccgaatctgctaccgctgctaaggaagctgccaagaatggtgctaag
caacctgcaaaggaagaatccaaggaagaatccaaggaaggtgctaaaccagcttctaaa
ccagctgccaagaaatcctctggatcttctgcttcttcaggtactagaatctttgcttct
ccattggccaagagcatcgctttggaacatggtgtttccttgaaggaagttgaaggtact
ggtccaagaggcagaatcactaaggatgatgttgaagccttcttggcctcggctccatct
cgtgaatcctccgctgctaaggccgctccagccctagctgccccaactccagcatccgcc
acttatgaagatgttccaatcagtaacatgagacaaatcatcggtgaccgtttgttgcaa
tccactcaaaatattccatcatacattgtttcctctcaaattagtgtttctaagcttttg
aagttgagacaatccttgaacgctactgctaaagaccaatacaagttgtccatcaatgac
atcttgatcaaggccattgctgttgctgctcagagatgtccagatgctaatgcttactgg
atgccagaacaaggtgtcatcagaaagttcaagaacgttgacgtctctgtcgctgttgct
accccaaccggtttgttgactccgatcgtcaagaacgccgaatccaagggccttgtttcc
atttctaaggaaatcaaggacttaggtaagcgtgctaaggataataagttgaagccagaa
gaattccaaggtggtactatctgtatctctaacttgggtatgaaccctgccgtttccatg
ttcacctctatcatcaacccaccacaatctaccatcttggctatcggtaccgttaacaag
gtcccagtcgaagatgctggttccgaattcggcttcacctttgaccaaaagatgaatatc
actggtactttcgatcacagaactatcgatggtgctaagggtggtgaattcatgaaggaa
ttgaagaaggttattgaaaacccattggaactattgttatga

DBGET integrated database retrieval system