KEGG   Kluyveromyces lactis: KLLA0F06072gHelp
Entry
KLLA0F06072g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
kla  Kluyveromyces lactis
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:kla01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:kla00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:kla00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:kla00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:583276..589971
Genome map
AA seq 2231 aa AA seqDB search
MSEENLSEVSISQSKQYEITEYSDRHSKLASHFIGLNTVDKADDSPLKEFVKSHGGHTVI
SKVLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPEDLEANAEYIRMADQYIEV
PGGTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFIGPPGNA
MRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCSSPEDGL
KKAKEIGFPIMVKASEGGGGKGIRKVENEDEFLSLYQQAANEIPGSPIFIMKLAGKARHL
EVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAAVRLGQLVGYV
SAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMGIPMHRIRDIR
LLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFKPSGGALHELN
FRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTT
VEYLIKLLETEDFEDNTITTGWLDDLISQKMTAEKPDRTLSVICGAATKAHIASQKARED
YISSLKRGQVPNKSLLQTMYPIEFIHDGMRYRFTVAKSADDRYTLFINGSKCEVGVRKLS
DGGLLIAVGGKSHTIYWKEEVAATRLSIDSKTTLLEVENDPTQLRTPSPGKLVKFLVENG
DHVIAGQPYAEVEVMKMQMPLISQENGVVQLLKQPGSTLAAGDILAILTLDDPSKVKHAK
PYEGMLPELGAPIVEGTKPAYKFKSLVTTLENILKGYDNQVIMNASLQQLIEVLRQPELP
YSEWKLQVSALHSRLPPKLDEMQEQLVTRSFKRNADFPARQLEKMLEAALNDPNVDPLFS
TTIEPLVDITTRYSKGLAAHEHFVFATFLENYYNVEKLFSGPNIREEDVILKLRDENPDD
LEKVVLTVLAHSRVSARNNLILAILKHYQPLCKLSSEVAAAIEQPLKHIVELESKATAKV
ALQAREILIQGALPSIKERTDQVQYILKSSVLSTSYGSSETKRTKPDLEVLKDLIDSNYV
VFDVLAQFLTNPDDAVSAAAAEVYIRRAYRAYTIGDLKHQKSSGSPVVEWKFQLPSAAFT
SLPQVKSKLGMNRAISVSDLTYVSDGENQPLRTGLLIPARHLDDVDGILSSALSLIPSHH
MSTGPVPDRSGSSASLSNVANVVVSSTEGFESESDVLKRLREILDLNKQSLVDSAIRRIT
FVFGYSDGTYPKYYTFRGPNYNEDETIRHIEPALAFQLELGKMSNFNIRQIFTENRNIHV
YEAVGKNSPVDKRFFTRGIIRTGRISDDISIHEYLTSEANRLMSDILDNLEIIDTSNSDL
NHIFINFSAVFDISPEAVEAAFGGFLERFGRRLLRLRVAAAEIRIIIKDPQTGTPVPIRA
LINNVSGFVVKTELYTEIKNAQGEWIFKSLDKPGAMHLRPIATPYPAKEWLQPKRYKAHL
MGTTYVYDFPELFRQATVAQWKKHSPKTKLSDDFFIANELIEDENGELTEVDRELGANNI
GMVAFKVTAKTPEYSHGRQFVIVANDITFKIGSFGPQEDAFFNKVTEYARKRGIPRIYLS
ANSGARIGIAEELVPLFQIAWNDEKDPAKGFQYLWLSDESLEELKSKGKDNAVVTECVVE
EGKVRNVITAIIGSEDGLGVECLKGSGLIAGATSRAYKDIFTITLVTCRSVGIGAYLVRL
GQRAIQIEAQPIILTGAPAINKLLGREVYSSNLQLGGTQIMYNNGVSHLTAPDDLAGVEK
IMDWLSYIPAKRDLPVPILESEDKWDRKIDYAPSLNEQYDVRWMIAGRESADGFEYGLFD
KGSFQETLSGWAKGVVTGRARLGGIPLGVIAVETRIVENLIPADPANPDSTEMLIQEAGQ
VWYPNSAFKTAQAINDFNHGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDYK
QPIITYIPPTGELRGGSWVVVDPTINADQMEMYADINSRAGVLEPEGMVGIKYRREKLLA
TMARLDDKYRELKAKLADSTLTPEEHQEVSKQLAIREKQLLPIYHQITVQFADLHDRSGR
MLAKGVIKKELDWPEARRFFFWRLRRRLNEEYLMRRLNNELGSASRLEKMARIISWYPAS
VSQDNDREVATWIEENYQFLDEQVKSLKLEAFAQNLAKSIRNDRENSINGLAEVLKLLSA
KDKEKLQKALE
NT seq 6696 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggaaaatctttctgaggtttcaatctctcaaagtaaacaatacgaaattact
gaatatagcgatagacattccaagttggcttctcatttcattggtctgaacactgtggat
aaggcagatgattctccattgaaagagtttgtcaaatcacatggtggtcatactgtgatc
tcaaaggttttgatcgctaacaatggtatcgcagccgttaaagaaatcagatcggttcgt
aaatgggcctatgaaaccttcggcgatgaaagaactgttcaattcgtggccatggccact
ccagaagatcttgaagccaacgcagaatacattcgtatggctgatcaatatatcgaagtt
cccggtggtaccaacaataacaattatgcaaacgttgacctaattgttgaagttgccgaa
agagctgatgtagatgcagtttgggcaggttggggtcatgcttcagaaaacccactactc
cctgaaaggctagccgcttctcacagaaagattatatttattggtccaccaggaaatgcc
atgagatctctcggtgataagatctcgtccactatcgttgcccaacacgctaaggttcct
tgtatcccatggtctggtactggtgtcgatgaagttcatgttgataaagaaactaacttg
gtctctgtcgaagataaagtataccaagaaggttgttgttcgtctccagaagacggtcta
aagaaagccaaggaaattggtttcccaattatggtcaaggcttccgaaggtggtggtggt
aaaggtatcagaaaagtcgaaaatgaagatgagttcctgtctttgtaccaacaagctgct
aatgaaattcctggttctccaatttttattatgaagttggctggtaaggctcgtcatttg
gaagttcaacttttggctgatcaatatggtaccaacatctctctatttggtcgtgattgt
tctgttcaaagacgtcatcaaaagattatcgaagaagctcctgtaactatcgctaagcca
gataccttcactgaaatggaaaaagcagccgtcagattaggtcaattggttggttacgtt
tctgctggtaccgtcgaatatttatattctcatgatgaagacaagttctacttcttggag
ttgaacccaagattacaagttgaacatccaaccacagaaatggttactggtgttaacttg
ccgtctgcccagttacaaatcgctatgggtattccaatgcacagaatcagagatattaga
ttgttatacggtgtcgatccaaaatctgcatccgaaattgactttaacttctctacacct
gagtctgctaaaactcaaagaaaaccaactcctaaaggtcactgtactgcctgccgtatc
acatccgaagatccaaatgagggtttcaaaccatctggcggtgctttacacgaattgaac
ttccgttcttcttccaacgtttggggttatttctctgttggtaataatggtggtatccat
tcattctctgactctcaattcggtcatatcttcgccttcggtgaaaacagacaagcttca
aggaaacatatggttgttgctttgaaggaattatctatcagaggtgatttcagaactacg
gttgaatatttaatcaaattattggaaaccgaagacttcgaagacaataccatcacgact
gggtggttggatgatttgatttctcagaaaatgacagctgaaaagcctgatagaacccta
tctgtcatttgtggtgccgctaccaaggctcatattgcctcccaaaaagccagagaagat
tacatctcatctttgaagagaggccaagttccaaacaaatcattactacaaacaatgtac
ccaattgaatttattcatgatggtatgagatatagatttactgttgctaaatcagccgac
gatcgttatactctattcattaacggttccaagtgcgaagttggcgtaaggaagttatct
gatggtggtttgttgattgccgttggtggtaaatcacacaccatttactggaaggaagaa
gttgctgctaccagattatcaatcgactctaagacaactctactagaggttgaaaatgat
ccaacacaactcagaactccatctcctggtaaattggtcaagtttttggtcgaaaacggt
gatcatgttattgctggccaaccatatgccgaagttgaagttatgaagatgcaaatgcca
ttgatttctcaagaaaatggtgtcgttcagttattgaaacaaccaggctctactctggcc
gccggtgacattctagccatcttaactctagatgaccctagtaaagtcaaacatgctaag
ccttacgaaggcatgctaccagaattgggtgctccaatcgttgaaggtaccaagcctgca
tacaaatttaaatctttggtcactactttggaaaacatcttgaagggatacgacaatcaa
gttattatgaatgcttcattgcagcaattaattgaagtgttgagacaaccagaattacca
tactctgaatggaaattacaagtttctgctttacattcaagattaccacctaagttagac
gaaatgcaagaacaattggtcacccgttcattcaagagaaatgcggatttcccagcaaga
caactagaaaagatgttagaagctgccttaaatgatcctaacgttgacccattgtttagc
actaccattgaaccacttgttgatattactacccgttactctaagggacttgctgctcat
gaacattttgtctttgccactttcttagaaaactattacaatgtcgaaaaattgttctct
gggccaaacattcgggaagaagacgtcatcttaaaattgcgtgatgagaaccctgacgac
ttggagaaggttgttttaaccgtcctagctcactccagagtatcagccagaaacaacctg
atccttgccattttgaagcattatcaaccgctatgcaaattgagctctgaggtagccgct
gctatcgaacaaccattgaaacacatcgtcgaattagaatctaaggccaccgctaaggtt
gctctacaagccagagaaattttgattcaaggtgctttgccatctatcaaggagagaaca
gatcaagttcaatacattcttaagtcatctgttttaagcacttcatatggttcatccgaa
acgaagcgcacaaaacctgatttagaagttttaaaggacttgatcgattccaactatgtt
gttttcgatgtgttggcccaattcttgacaaatccagatgatgccgtttctgctgctgct
gccgaggtctacattagaagagcatacagagcgtacactattggtgatttgaagcatcaa
aagtcttctggatcacctgtagttgagtggaagttccaacttccatctgctgcattcacc
tcattgccacaggttaagagtaaattgggtatgaacagagctatttctgtctctgatttg
acttatgtctctgacggtgaaaaccaaccattaagaactggtttgttgattcctgctaga
catctagatgatgttgatggtattttgtcgtcagctctatctttaattccttctcatcat
atgtctactggccctgtcccagacagatctggctcttcagccagcttgtctaatgttgcc
aatgttgttgtgtcttcaactgaaggatttgaatctgagtcggatgttttaaagagactc
agagagatactcgatttaaacaagcaatcattagttgactctgctattcgtcgtattacc
ttcgtgtttggatacagtgatggtacatatccaaagtactataccttccgtggtccaaat
tacaatgaagatgaaacaattcgtcacattgaaccagctctagctttccaacttgaacta
ggtaagatgtcgaacttcaatatcagacaaatatttactgagaacagaaacattcatgtc
tatgaggccgttggtaaaaactctccggttgacaagagattctttaccagaggtattatc
agaacaggtcgtattagtgacgacatttccatccatgaatatttgacttcagaagctaac
agattaatgagtgacattttggacaacttagagatcattgacacttctaactcagatctt
aaccatattttcattaacttctctgctgtatttgacatttcgccagaagctgttgaagct
gcctttggcggtttcttggaaagatttggcagaagattgctcagattacgtgttgccgct
gctgaaatcagaattattatcaaggaccctcaaactggcaccccggttccaatcagagcg
ttgatcaacaacgtctcgggctttgttgtgaagactgaattgtatacagagatcaagaat
gcacaaggtgaatggattttcaaatctttagataaaccaggtgctatgcatttgagacct
attgccactccttatcctgcaaaggagtggttacagccaaaacgttacaaggctcatttg
atgggaaccacatacgtttacgatttcccagagctattccgtcaagccaccgtggcacaa
tggaagaaacactctccaaagaccaagttgtcagacgattttttcattgcaaatgaattg
attgaagatgaaaatggtgaattaactgaagttgatcgtgaacttggtgctaataacatc
ggtatggttgcattcaaggttactgcaaaaactccagaatactctcatggccgtcaattt
gtcatagtcgccaatgatatcactttcaaaattggttcgttcggtccacaggaagatgcc
ttcttcaacaaggttactgaatatgcaagaaagcgtggtatcccaagaatatacttatct
gccaattcaggtgcaagaattggtattgccgaagagcttgttccattgttccagattgct
tggaatgatgaaaaagatccagcaaagggtttccaatacttatggttgtcagatgagtct
cttgaagaactcaaatctaagggtaaagacaatgctgttgttaccgaatgtgttgttgaa
gaaggtaaggtcagaaacgtcattactgctattatcggttcggaagatggtcttggtgtt
gagtgtttgaagggatccggtttaattgcaggtgccacttcaagagcgtacaaggatatc
ttcacgatcaccttagttacttgtaggtctgtgggtatcggtgcttatctagtcagatta
ggtcaaagagccattcaaatcgaagcacagccaatcattttaaccggtgctcctgccatc
aataagcttcttggtagagaagtttactcttcaaacttgcaattgggtggtactcagatc
atgtacaacaatggtgtttcacacttaactgctccagatgatttggctggtgttgaaaag
atcatggactggttatcttacattcctgccaaacgtgatctaccggttcctattttggaa
tctgaagataaatgggacagaaaaattgactatgctccatctttaaacgaacagtacgat
gttaggtggatgattgcaggtcgtgaatctgccgatggtttcgaatatggtcttttcgat
aaaggttccttccaagaaaccttgtctggttgggccaagggtgttgttacaggtagagcc
cgtttaggtggtattccattaggtgttattgccgttgaaacaagaattgtcgaaaatttg
attcctgctgatcctgctaatcctgattctaccgaaatgttgattcaagaagccggccaa
gtttggtatccaaattccgcgttcaagacagcccaggctatcaatgacttcaatcatggt
gaacaattgccattaatgatcctagccaactggagaggtttctctggtggacaacgtgat
atgtacaacgaagttttgaagtatggttctttcatcgttgatgcattggttgattacaaa
cagcctataattacatacattcctccaactggtgaactaagaggtggttcttgggttgtt
gttgatccaactatcaatgctgaccaaatggaaatgtatgctgatataaactcaagagct
ggtgttttggaaccagaaggtatggtcggtatcaaataccgtagagaaaaattgttggct
actatggcaagattagatgacaagtacagagagttgaaagccaagttggccgattccact
ttgactccagaagaacatcaagaagtatcaaagcagcttgctatccgtgagaagcaattg
ttgccaatttaccatcaaattacagtacagtttgctgacttgcatgatagatccggtcgt
atgttggcaaagggtgtgatcaaaaaggaattggactggccagaagctcgtcgcttcttt
ttctggagattaagaagaagattaaacgaagaatatttgatgagaagattaaataacgag
ctaggatctgcttctagactagagaaaatggcaagaatcatatcatggtacccagcttct
gtgagccaagataacgacagagaagttgctacttggatcgaagaaaactaccaattcttg
gatgaacaagttaagagtctgaagttggaagctttcgcacaaaatttggcaaaatctatc
agaaacgaccgtgaaaattccatcaatggtttggcggaagttttgaaattattgtctgcc
aaagacaaagaaaagcttcaaaaagctttggaatga

DBGET integrated database retrieval system