KEGG   Kluyveromyces lactis: KLLA0F06072gHelp
Entry
KLLA0F06072g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
kla  Kluyveromyces lactis
Pathway
kla00061  Fatty acid biosynthesis
kla00620  Pyruvate metabolism
kla00640  Propanoate metabolism
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
kla01130  Biosynthesis of antibiotics
kla01212  Fatty acid metabolism
Module
kla_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KLLA0F06072g
   00640 Propanoate metabolism
    KLLA0F06072g
  Lipid metabolism
   00061 Fatty acid biosynthesis
    KLLA0F06072g
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    KLLA0F06072g
Enzymes [BR:kla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     KLLA0F06072g
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     KLLA0F06072g
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     KLLA0F06072g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter ATP-grasp_3 Dala_Dala_lig_C Biotin_lipoyl_2 ABC_tran_CTD
Motif
Other DBs
NCBI-GeneID: 2895282
NCBI-ProteinID: XP_455355
UniProt: Q6CL34
Position
F:583276..589971
Genome map
AA seq 2231 aa AA seqDB search
MSEENLSEVSISQSKQYEITEYSDRHSKLASHFIGLNTVDKADDSPLKEFVKSHGGHTVI
SKVLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPEDLEANAEYIRMADQYIEV
PGGTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFIGPPGNA
MRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCSSPEDGL
KKAKEIGFPIMVKASEGGGGKGIRKVENEDEFLSLYQQAANEIPGSPIFIMKLAGKARHL
EVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAAVRLGQLVGYV
SAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMGIPMHRIRDIR
LLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFKPSGGALHELN
FRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTT
VEYLIKLLETEDFEDNTITTGWLDDLISQKMTAEKPDRTLSVICGAATKAHIASQKARED
YISSLKRGQVPNKSLLQTMYPIEFIHDGMRYRFTVAKSADDRYTLFINGSKCEVGVRKLS
DGGLLIAVGGKSHTIYWKEEVAATRLSIDSKTTLLEVENDPTQLRTPSPGKLVKFLVENG
DHVIAGQPYAEVEVMKMQMPLISQENGVVQLLKQPGSTLAAGDILAILTLDDPSKVKHAK
PYEGMLPELGAPIVEGTKPAYKFKSLVTTLENILKGYDNQVIMNASLQQLIEVLRQPELP
YSEWKLQVSALHSRLPPKLDEMQEQLVTRSFKRNADFPARQLEKMLEAALNDPNVDPLFS
TTIEPLVDITTRYSKGLAAHEHFVFATFLENYYNVEKLFSGPNIREEDVILKLRDENPDD
LEKVVLTVLAHSRVSARNNLILAILKHYQPLCKLSSEVAAAIEQPLKHIVELESKATAKV
ALQAREILIQGALPSIKERTDQVQYILKSSVLSTSYGSSETKRTKPDLEVLKDLIDSNYV
VFDVLAQFLTNPDDAVSAAAAEVYIRRAYRAYTIGDLKHQKSSGSPVVEWKFQLPSAAFT
SLPQVKSKLGMNRAISVSDLTYVSDGENQPLRTGLLIPARHLDDVDGILSSALSLIPSHH
MSTGPVPDRSGSSASLSNVANVVVSSTEGFESESDVLKRLREILDLNKQSLVDSAIRRIT
FVFGYSDGTYPKYYTFRGPNYNEDETIRHIEPALAFQLELGKMSNFNIRQIFTENRNIHV
YEAVGKNSPVDKRFFTRGIIRTGRISDDISIHEYLTSEANRLMSDILDNLEIIDTSNSDL
NHIFINFSAVFDISPEAVEAAFGGFLERFGRRLLRLRVAAAEIRIIIKDPQTGTPVPIRA
LINNVSGFVVKTELYTEIKNAQGEWIFKSLDKPGAMHLRPIATPYPAKEWLQPKRYKAHL
MGTTYVYDFPELFRQATVAQWKKHSPKTKLSDDFFIANELIEDENGELTEVDRELGANNI
GMVAFKVTAKTPEYSHGRQFVIVANDITFKIGSFGPQEDAFFNKVTEYARKRGIPRIYLS
ANSGARIGIAEELVPLFQIAWNDEKDPAKGFQYLWLSDESLEELKSKGKDNAVVTECVVE
EGKVRNVITAIIGSEDGLGVECLKGSGLIAGATSRAYKDIFTITLVTCRSVGIGAYLVRL
GQRAIQIEAQPIILTGAPAINKLLGREVYSSNLQLGGTQIMYNNGVSHLTAPDDLAGVEK
IMDWLSYIPAKRDLPVPILESEDKWDRKIDYAPSLNEQYDVRWMIAGRESADGFEYGLFD
KGSFQETLSGWAKGVVTGRARLGGIPLGVIAVETRIVENLIPADPANPDSTEMLIQEAGQ
VWYPNSAFKTAQAINDFNHGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDYK
QPIITYIPPTGELRGGSWVVVDPTINADQMEMYADINSRAGVLEPEGMVGIKYRREKLLA
TMARLDDKYRELKAKLADSTLTPEEHQEVSKQLAIREKQLLPIYHQITVQFADLHDRSGR
MLAKGVIKKELDWPEARRFFFWRLRRRLNEEYLMRRLNNELGSASRLEKMARIISWYPAS
VSQDNDREVATWIEENYQFLDEQVKSLKLEAFAQNLAKSIRNDRENSINGLAEVLKLLSA
KDKEKLQKALE
NT seq 6696 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggaaaatctttctgaggtttcaatctctcaaagtaaacaatacgaaattact
gaatatagcgatagacattccaagttggcttctcatttcattggtctgaacactgtggat
aaggcagatgattctccattgaaagagtttgtcaaatcacatggtggtcatactgtgatc
tcaaaggttttgatcgctaacaatggtatcgcagccgttaaagaaatcagatcggttcgt
aaatgggcctatgaaaccttcggcgatgaaagaactgttcaattcgtggccatggccact
ccagaagatcttgaagccaacgcagaatacattcgtatggctgatcaatatatcgaagtt
cccggtggtaccaacaataacaattatgcaaacgttgacctaattgttgaagttgccgaa
agagctgatgtagatgcagtttgggcaggttggggtcatgcttcagaaaacccactactc
cctgaaaggctagccgcttctcacagaaagattatatttattggtccaccaggaaatgcc
atgagatctctcggtgataagatctcgtccactatcgttgcccaacacgctaaggttcct
tgtatcccatggtctggtactggtgtcgatgaagttcatgttgataaagaaactaacttg
gtctctgtcgaagataaagtataccaagaaggttgttgttcgtctccagaagacggtcta
aagaaagccaaggaaattggtttcccaattatggtcaaggcttccgaaggtggtggtggt
aaaggtatcagaaaagtcgaaaatgaagatgagttcctgtctttgtaccaacaagctgct
aatgaaattcctggttctccaatttttattatgaagttggctggtaaggctcgtcatttg
gaagttcaacttttggctgatcaatatggtaccaacatctctctatttggtcgtgattgt
tctgttcaaagacgtcatcaaaagattatcgaagaagctcctgtaactatcgctaagcca
gataccttcactgaaatggaaaaagcagccgtcagattaggtcaattggttggttacgtt
tctgctggtaccgtcgaatatttatattctcatgatgaagacaagttctacttcttggag
ttgaacccaagattacaagttgaacatccaaccacagaaatggttactggtgttaacttg
ccgtctgcccagttacaaatcgctatgggtattccaatgcacagaatcagagatattaga
ttgttatacggtgtcgatccaaaatctgcatccgaaattgactttaacttctctacacct
gagtctgctaaaactcaaagaaaaccaactcctaaaggtcactgtactgcctgccgtatc
acatccgaagatccaaatgagggtttcaaaccatctggcggtgctttacacgaattgaac
ttccgttcttcttccaacgtttggggttatttctctgttggtaataatggtggtatccat
tcattctctgactctcaattcggtcatatcttcgccttcggtgaaaacagacaagcttca
aggaaacatatggttgttgctttgaaggaattatctatcagaggtgatttcagaactacg
gttgaatatttaatcaaattattggaaaccgaagacttcgaagacaataccatcacgact
gggtggttggatgatttgatttctcagaaaatgacagctgaaaagcctgatagaacccta
tctgtcatttgtggtgccgctaccaaggctcatattgcctcccaaaaagccagagaagat
tacatctcatctttgaagagaggccaagttccaaacaaatcattactacaaacaatgtac
ccaattgaatttattcatgatggtatgagatatagatttactgttgctaaatcagccgac
gatcgttatactctattcattaacggttccaagtgcgaagttggcgtaaggaagttatct
gatggtggtttgttgattgccgttggtggtaaatcacacaccatttactggaaggaagaa
gttgctgctaccagattatcaatcgactctaagacaactctactagaggttgaaaatgat
ccaacacaactcagaactccatctcctggtaaattggtcaagtttttggtcgaaaacggt
gatcatgttattgctggccaaccatatgccgaagttgaagttatgaagatgcaaatgcca
ttgatttctcaagaaaatggtgtcgttcagttattgaaacaaccaggctctactctggcc
gccggtgacattctagccatcttaactctagatgaccctagtaaagtcaaacatgctaag
ccttacgaaggcatgctaccagaattgggtgctccaatcgttgaaggtaccaagcctgca
tacaaatttaaatctttggtcactactttggaaaacatcttgaagggatacgacaatcaa
gttattatgaatgcttcattgcagcaattaattgaagtgttgagacaaccagaattacca
tactctgaatggaaattacaagtttctgctttacattcaagattaccacctaagttagac
gaaatgcaagaacaattggtcacccgttcattcaagagaaatgcggatttcccagcaaga
caactagaaaagatgttagaagctgccttaaatgatcctaacgttgacccattgtttagc
actaccattgaaccacttgttgatattactacccgttactctaagggacttgctgctcat
gaacattttgtctttgccactttcttagaaaactattacaatgtcgaaaaattgttctct
gggccaaacattcgggaagaagacgtcatcttaaaattgcgtgatgagaaccctgacgac
ttggagaaggttgttttaaccgtcctagctcactccagagtatcagccagaaacaacctg
atccttgccattttgaagcattatcaaccgctatgcaaattgagctctgaggtagccgct
gctatcgaacaaccattgaaacacatcgtcgaattagaatctaaggccaccgctaaggtt
gctctacaagccagagaaattttgattcaaggtgctttgccatctatcaaggagagaaca
gatcaagttcaatacattcttaagtcatctgttttaagcacttcatatggttcatccgaa
acgaagcgcacaaaacctgatttagaagttttaaaggacttgatcgattccaactatgtt
gttttcgatgtgttggcccaattcttgacaaatccagatgatgccgtttctgctgctgct
gccgaggtctacattagaagagcatacagagcgtacactattggtgatttgaagcatcaa
aagtcttctggatcacctgtagttgagtggaagttccaacttccatctgctgcattcacc
tcattgccacaggttaagagtaaattgggtatgaacagagctatttctgtctctgatttg
acttatgtctctgacggtgaaaaccaaccattaagaactggtttgttgattcctgctaga
catctagatgatgttgatggtattttgtcgtcagctctatctttaattccttctcatcat
atgtctactggccctgtcccagacagatctggctcttcagccagcttgtctaatgttgcc
aatgttgttgtgtcttcaactgaaggatttgaatctgagtcggatgttttaaagagactc
agagagatactcgatttaaacaagcaatcattagttgactctgctattcgtcgtattacc
ttcgtgtttggatacagtgatggtacatatccaaagtactataccttccgtggtccaaat
tacaatgaagatgaaacaattcgtcacattgaaccagctctagctttccaacttgaacta
ggtaagatgtcgaacttcaatatcagacaaatatttactgagaacagaaacattcatgtc
tatgaggccgttggtaaaaactctccggttgacaagagattctttaccagaggtattatc
agaacaggtcgtattagtgacgacatttccatccatgaatatttgacttcagaagctaac
agattaatgagtgacattttggacaacttagagatcattgacacttctaactcagatctt
aaccatattttcattaacttctctgctgtatttgacatttcgccagaagctgttgaagct
gcctttggcggtttcttggaaagatttggcagaagattgctcagattacgtgttgccgct
gctgaaatcagaattattatcaaggaccctcaaactggcaccccggttccaatcagagcg
ttgatcaacaacgtctcgggctttgttgtgaagactgaattgtatacagagatcaagaat
gcacaaggtgaatggattttcaaatctttagataaaccaggtgctatgcatttgagacct
attgccactccttatcctgcaaaggagtggttacagccaaaacgttacaaggctcatttg
atgggaaccacatacgtttacgatttcccagagctattccgtcaagccaccgtggcacaa
tggaagaaacactctccaaagaccaagttgtcagacgattttttcattgcaaatgaattg
attgaagatgaaaatggtgaattaactgaagttgatcgtgaacttggtgctaataacatc
ggtatggttgcattcaaggttactgcaaaaactccagaatactctcatggccgtcaattt
gtcatagtcgccaatgatatcactttcaaaattggttcgttcggtccacaggaagatgcc
ttcttcaacaaggttactgaatatgcaagaaagcgtggtatcccaagaatatacttatct
gccaattcaggtgcaagaattggtattgccgaagagcttgttccattgttccagattgct
tggaatgatgaaaaagatccagcaaagggtttccaatacttatggttgtcagatgagtct
cttgaagaactcaaatctaagggtaaagacaatgctgttgttaccgaatgtgttgttgaa
gaaggtaaggtcagaaacgtcattactgctattatcggttcggaagatggtcttggtgtt
gagtgtttgaagggatccggtttaattgcaggtgccacttcaagagcgtacaaggatatc
ttcacgatcaccttagttacttgtaggtctgtgggtatcggtgcttatctagtcagatta
ggtcaaagagccattcaaatcgaagcacagccaatcattttaaccggtgctcctgccatc
aataagcttcttggtagagaagtttactcttcaaacttgcaattgggtggtactcagatc
atgtacaacaatggtgtttcacacttaactgctccagatgatttggctggtgttgaaaag
atcatggactggttatcttacattcctgccaaacgtgatctaccggttcctattttggaa
tctgaagataaatgggacagaaaaattgactatgctccatctttaaacgaacagtacgat
gttaggtggatgattgcaggtcgtgaatctgccgatggtttcgaatatggtcttttcgat
aaaggttccttccaagaaaccttgtctggttgggccaagggtgttgttacaggtagagcc
cgtttaggtggtattccattaggtgttattgccgttgaaacaagaattgtcgaaaatttg
attcctgctgatcctgctaatcctgattctaccgaaatgttgattcaagaagccggccaa
gtttggtatccaaattccgcgttcaagacagcccaggctatcaatgacttcaatcatggt
gaacaattgccattaatgatcctagccaactggagaggtttctctggtggacaacgtgat
atgtacaacgaagttttgaagtatggttctttcatcgttgatgcattggttgattacaaa
cagcctataattacatacattcctccaactggtgaactaagaggtggttcttgggttgtt
gttgatccaactatcaatgctgaccaaatggaaatgtatgctgatataaactcaagagct
ggtgttttggaaccagaaggtatggtcggtatcaaataccgtagagaaaaattgttggct
actatggcaagattagatgacaagtacagagagttgaaagccaagttggccgattccact
ttgactccagaagaacatcaagaagtatcaaagcagcttgctatccgtgagaagcaattg
ttgccaatttaccatcaaattacagtacagtttgctgacttgcatgatagatccggtcgt
atgttggcaaagggtgtgatcaaaaaggaattggactggccagaagctcgtcgcttcttt
ttctggagattaagaagaagattaaacgaagaatatttgatgagaagattaaataacgag
ctaggatctgcttctagactagagaaaatggcaagaatcatatcatggtacccagcttct
gtgagccaagataacgacagagaagttgctacttggatcgaagaaaactaccaattcttg
gatgaacaagttaagagtctgaagttggaagctttcgcacaaaatttggcaaaatctatc
agaaacgaccgtgaaaattccatcaatggtttggcggaagttttgaaattattgtctgcc
aaagacaaagaaaagcttcaaaaagctttggaatga

DBGET integrated database retrieval system