KEGG   Kluyveromyces lactis: KLLA0F06072gHelp
Entry
KLLA0F06072g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
kla  Kluyveromyces lactis
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    KLLA0F06072g
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KLLA0F06072g
   00640 Propanoate metabolism
    KLLA0F06072g
  Lipid metabolism
   00061 Fatty acid biosynthesis
    KLLA0F06072g
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    KLLA0F06072g
Enzymes [BR:kla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     KLLA0F06072g
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     KLLA0F06072g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:583276..589971
Genome map
AA seq 2231 aa AA seqDB search
MSEENLSEVSISQSKQYEITEYSDRHSKLASHFIGLNTVDKADDSPLKEFVKSHGGHTVI
SKVLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPEDLEANAEYIRMADQYIEV
PGGTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFIGPPGNA
MRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCSSPEDGL
KKAKEIGFPIMVKASEGGGGKGIRKVENEDEFLSLYQQAANEIPGSPIFIMKLAGKARHL
EVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAAVRLGQLVGYV
SAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMGIPMHRIRDIR
LLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFKPSGGALHELN
FRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTT
VEYLIKLLETEDFEDNTITTGWLDDLISQKMTAEKPDRTLSVICGAATKAHIASQKARED
YISSLKRGQVPNKSLLQTMYPIEFIHDGMRYRFTVAKSADDRYTLFINGSKCEVGVRKLS
DGGLLIAVGGKSHTIYWKEEVAATRLSIDSKTTLLEVENDPTQLRTPSPGKLVKFLVENG
DHVIAGQPYAEVEVMKMQMPLISQENGVVQLLKQPGSTLAAGDILAILTLDDPSKVKHAK
PYEGMLPELGAPIVEGTKPAYKFKSLVTTLENILKGYDNQVIMNASLQQLIEVLRQPELP
YSEWKLQVSALHSRLPPKLDEMQEQLVTRSFKRNADFPARQLEKMLEAALNDPNVDPLFS
TTIEPLVDITTRYSKGLAAHEHFVFATFLENYYNVEKLFSGPNIREEDVILKLRDENPDD
LEKVVLTVLAHSRVSARNNLILAILKHYQPLCKLSSEVAAAIEQPLKHIVELESKATAKV
ALQAREILIQGALPSIKERTDQVQYILKSSVLSTSYGSSETKRTKPDLEVLKDLIDSNYV
VFDVLAQFLTNPDDAVSAAAAEVYIRRAYRAYTIGDLKHQKSSGSPVVEWKFQLPSAAFT
SLPQVKSKLGMNRAISVSDLTYVSDGENQPLRTGLLIPARHLDDVDGILSSALSLIPSHH
MSTGPVPDRSGSSASLSNVANVVVSSTEGFESESDVLKRLREILDLNKQSLVDSAIRRIT
FVFGYSDGTYPKYYTFRGPNYNEDETIRHIEPALAFQLELGKMSNFNIRQIFTENRNIHV
YEAVGKNSPVDKRFFTRGIIRTGRISDDISIHEYLTSEANRLMSDILDNLEIIDTSNSDL
NHIFINFSAVFDISPEAVEAAFGGFLERFGRRLLRLRVAAAEIRIIIKDPQTGTPVPIRA
LINNVSGFVVKTELYTEIKNAQGEWIFKSLDKPGAMHLRPIATPYPAKEWLQPKRYKAHL
MGTTYVYDFPELFRQATVAQWKKHSPKTKLSDDFFIANELIEDENGELTEVDRELGANNI
GMVAFKVTAKTPEYSHGRQFVIVANDITFKIGSFGPQEDAFFNKVTEYARKRGIPRIYLS
ANSGARIGIAEELVPLFQIAWNDEKDPAKGFQYLWLSDESLEELKSKGKDNAVVTECVVE
EGKVRNVITAIIGSEDGLGVECLKGSGLIAGATSRAYKDIFTITLVTCRSVGIGAYLVRL
GQRAIQIEAQPIILTGAPAINKLLGREVYSSNLQLGGTQIMYNNGVSHLTAPDDLAGVEK
IMDWLSYIPAKRDLPVPILESEDKWDRKIDYAPSLNEQYDVRWMIAGRESADGFEYGLFD
KGSFQETLSGWAKGVVTGRARLGGIPLGVIAVETRIVENLIPADPANPDSTEMLIQEAGQ
VWYPNSAFKTAQAINDFNHGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDYK
QPIITYIPPTGELRGGSWVVVDPTINADQMEMYADINSRAGVLEPEGMVGIKYRREKLLA
TMARLDDKYRELKAKLADSTLTPEEHQEVSKQLAIREKQLLPIYHQITVQFADLHDRSGR
MLAKGVIKKELDWPEARRFFFWRLRRRLNEEYLMRRLNNELGSASRLEKMARIISWYPAS
VSQDNDREVATWIEENYQFLDEQVKSLKLEAFAQNLAKSIRNDRENSINGLAEVLKLLSA
KDKEKLQKALE
NT seq 6696 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggaaaatctttctgaggtttcaatctctcaaagtaaacaatacgaaattact
gaatatagcgatagacattccaagttggcttctcatttcattggtctgaacactgtggat
aaggcagatgattctccattgaaagagtttgtcaaatcacatggtggtcatactgtgatc
tcaaaggttttgatcgctaacaatggtatcgcagccgttaaagaaatcagatcggttcgt
aaatgggcctatgaaaccttcggcgatgaaagaactgttcaattcgtggccatggccact
ccagaagatcttgaagccaacgcagaatacattcgtatggctgatcaatatatcgaagtt
cccggtggtaccaacaataacaattatgcaaacgttgacctaattgttgaagttgccgaa
agagctgatgtagatgcagtttgggcaggttggggtcatgcttcagaaaacccactactc
cctgaaaggctagccgcttctcacagaaagattatatttattggtccaccaggaaatgcc
atgagatctctcggtgataagatctcgtccactatcgttgcccaacacgctaaggttcct
tgtatcccatggtctggtactggtgtcgatgaagttcatgttgataaagaaactaacttg
gtctctgtcgaagataaagtataccaagaaggttgttgttcgtctccagaagacggtcta
aagaaagccaaggaaattggtttcccaattatggtcaaggcttccgaaggtggtggtggt
aaaggtatcagaaaagtcgaaaatgaagatgagttcctgtctttgtaccaacaagctgct
aatgaaattcctggttctccaatttttattatgaagttggctggtaaggctcgtcatttg
gaagttcaacttttggctgatcaatatggtaccaacatctctctatttggtcgtgattgt
tctgttcaaagacgtcatcaaaagattatcgaagaagctcctgtaactatcgctaagcca
gataccttcactgaaatggaaaaagcagccgtcagattaggtcaattggttggttacgtt
tctgctggtaccgtcgaatatttatattctcatgatgaagacaagttctacttcttggag
ttgaacccaagattacaagttgaacatccaaccacagaaatggttactggtgttaacttg
ccgtctgcccagttacaaatcgctatgggtattccaatgcacagaatcagagatattaga
ttgttatacggtgtcgatccaaaatctgcatccgaaattgactttaacttctctacacct
gagtctgctaaaactcaaagaaaaccaactcctaaaggtcactgtactgcctgccgtatc
acatccgaagatccaaatgagggtttcaaaccatctggcggtgctttacacgaattgaac
ttccgttcttcttccaacgtttggggttatttctctgttggtaataatggtggtatccat
tcattctctgactctcaattcggtcatatcttcgccttcggtgaaaacagacaagcttca
aggaaacatatggttgttgctttgaaggaattatctatcagaggtgatttcagaactacg
gttgaatatttaatcaaattattggaaaccgaagacttcgaagacaataccatcacgact
gggtggttggatgatttgatttctcagaaaatgacagctgaaaagcctgatagaacccta
tctgtcatttgtggtgccgctaccaaggctcatattgcctcccaaaaagccagagaagat
tacatctcatctttgaagagaggccaagttccaaacaaatcattactacaaacaatgtac
ccaattgaatttattcatgatggtatgagatatagatttactgttgctaaatcagccgac
gatcgttatactctattcattaacggttccaagtgcgaagttggcgtaaggaagttatct
gatggtggtttgttgattgccgttggtggtaaatcacacaccatttactggaaggaagaa
gttgctgctaccagattatcaatcgactctaagacaactctactagaggttgaaaatgat
ccaacacaactcagaactccatctcctggtaaattggtcaagtttttggtcgaaaacggt
gatcatgttattgctggccaaccatatgccgaagttgaagttatgaagatgcaaatgcca
ttgatttctcaagaaaatggtgtcgttcagttattgaaacaaccaggctctactctggcc
gccggtgacattctagccatcttaactctagatgaccctagtaaagtcaaacatgctaag
ccttacgaaggcatgctaccagaattgggtgctccaatcgttgaaggtaccaagcctgca
tacaaatttaaatctttggtcactactttggaaaacatcttgaagggatacgacaatcaa
gttattatgaatgcttcattgcagcaattaattgaagtgttgagacaaccagaattacca
tactctgaatggaaattacaagtttctgctttacattcaagattaccacctaagttagac
gaaatgcaagaacaattggtcacccgttcattcaagagaaatgcggatttcccagcaaga
caactagaaaagatgttagaagctgccttaaatgatcctaacgttgacccattgtttagc
actaccattgaaccacttgttgatattactacccgttactctaagggacttgctgctcat
gaacattttgtctttgccactttcttagaaaactattacaatgtcgaaaaattgttctct
gggccaaacattcgggaagaagacgtcatcttaaaattgcgtgatgagaaccctgacgac
ttggagaaggttgttttaaccgtcctagctcactccagagtatcagccagaaacaacctg
atccttgccattttgaagcattatcaaccgctatgcaaattgagctctgaggtagccgct
gctatcgaacaaccattgaaacacatcgtcgaattagaatctaaggccaccgctaaggtt
gctctacaagccagagaaattttgattcaaggtgctttgccatctatcaaggagagaaca
gatcaagttcaatacattcttaagtcatctgttttaagcacttcatatggttcatccgaa
acgaagcgcacaaaacctgatttagaagttttaaaggacttgatcgattccaactatgtt
gttttcgatgtgttggcccaattcttgacaaatccagatgatgccgtttctgctgctgct
gccgaggtctacattagaagagcatacagagcgtacactattggtgatttgaagcatcaa
aagtcttctggatcacctgtagttgagtggaagttccaacttccatctgctgcattcacc
tcattgccacaggttaagagtaaattgggtatgaacagagctatttctgtctctgatttg
acttatgtctctgacggtgaaaaccaaccattaagaactggtttgttgattcctgctaga
catctagatgatgttgatggtattttgtcgtcagctctatctttaattccttctcatcat
atgtctactggccctgtcccagacagatctggctcttcagccagcttgtctaatgttgcc
aatgttgttgtgtcttcaactgaaggatttgaatctgagtcggatgttttaaagagactc
agagagatactcgatttaaacaagcaatcattagttgactctgctattcgtcgtattacc
ttcgtgtttggatacagtgatggtacatatccaaagtactataccttccgtggtccaaat
tacaatgaagatgaaacaattcgtcacattgaaccagctctagctttccaacttgaacta
ggtaagatgtcgaacttcaatatcagacaaatatttactgagaacagaaacattcatgtc
tatgaggccgttggtaaaaactctccggttgacaagagattctttaccagaggtattatc
agaacaggtcgtattagtgacgacatttccatccatgaatatttgacttcagaagctaac
agattaatgagtgacattttggacaacttagagatcattgacacttctaactcagatctt
aaccatattttcattaacttctctgctgtatttgacatttcgccagaagctgttgaagct
gcctttggcggtttcttggaaagatttggcagaagattgctcagattacgtgttgccgct
gctgaaatcagaattattatcaaggaccctcaaactggcaccccggttccaatcagagcg
ttgatcaacaacgtctcgggctttgttgtgaagactgaattgtatacagagatcaagaat
gcacaaggtgaatggattttcaaatctttagataaaccaggtgctatgcatttgagacct
attgccactccttatcctgcaaaggagtggttacagccaaaacgttacaaggctcatttg
atgggaaccacatacgtttacgatttcccagagctattccgtcaagccaccgtggcacaa
tggaagaaacactctccaaagaccaagttgtcagacgattttttcattgcaaatgaattg
attgaagatgaaaatggtgaattaactgaagttgatcgtgaacttggtgctaataacatc
ggtatggttgcattcaaggttactgcaaaaactccagaatactctcatggccgtcaattt
gtcatagtcgccaatgatatcactttcaaaattggttcgttcggtccacaggaagatgcc
ttcttcaacaaggttactgaatatgcaagaaagcgtggtatcccaagaatatacttatct
gccaattcaggtgcaagaattggtattgccgaagagcttgttccattgttccagattgct
tggaatgatgaaaaagatccagcaaagggtttccaatacttatggttgtcagatgagtct
cttgaagaactcaaatctaagggtaaagacaatgctgttgttaccgaatgtgttgttgaa
gaaggtaaggtcagaaacgtcattactgctattatcggttcggaagatggtcttggtgtt
gagtgtttgaagggatccggtttaattgcaggtgccacttcaagagcgtacaaggatatc
ttcacgatcaccttagttacttgtaggtctgtgggtatcggtgcttatctagtcagatta
ggtcaaagagccattcaaatcgaagcacagccaatcattttaaccggtgctcctgccatc
aataagcttcttggtagagaagtttactcttcaaacttgcaattgggtggtactcagatc
atgtacaacaatggtgtttcacacttaactgctccagatgatttggctggtgttgaaaag
atcatggactggttatcttacattcctgccaaacgtgatctaccggttcctattttggaa
tctgaagataaatgggacagaaaaattgactatgctccatctttaaacgaacagtacgat
gttaggtggatgattgcaggtcgtgaatctgccgatggtttcgaatatggtcttttcgat
aaaggttccttccaagaaaccttgtctggttgggccaagggtgttgttacaggtagagcc
cgtttaggtggtattccattaggtgttattgccgttgaaacaagaattgtcgaaaatttg
attcctgctgatcctgctaatcctgattctaccgaaatgttgattcaagaagccggccaa
gtttggtatccaaattccgcgttcaagacagcccaggctatcaatgacttcaatcatggt
gaacaattgccattaatgatcctagccaactggagaggtttctctggtggacaacgtgat
atgtacaacgaagttttgaagtatggttctttcatcgttgatgcattggttgattacaaa
cagcctataattacatacattcctccaactggtgaactaagaggtggttcttgggttgtt
gttgatccaactatcaatgctgaccaaatggaaatgtatgctgatataaactcaagagct
ggtgttttggaaccagaaggtatggtcggtatcaaataccgtagagaaaaattgttggct
actatggcaagattagatgacaagtacagagagttgaaagccaagttggccgattccact
ttgactccagaagaacatcaagaagtatcaaagcagcttgctatccgtgagaagcaattg
ttgccaatttaccatcaaattacagtacagtttgctgacttgcatgatagatccggtcgt
atgttggcaaagggtgtgatcaaaaaggaattggactggccagaagctcgtcgcttcttt
ttctggagattaagaagaagattaaacgaagaatatttgatgagaagattaaataacgag
ctaggatctgcttctagactagagaaaatggcaagaatcatatcatggtacccagcttct
gtgagccaagataacgacagagaagttgctacttggatcgaagaaaactaccaattcttg
gatgaacaagttaagagtctgaagttggaagctttcgcacaaaatttggcaaaatctatc
agaaacgaccgtgaaaattccatcaatggtttggcggaagttttgaaattattgtctgcc
aaagacaaagaaaagcttcaaaaagctttggaatga

DBGET integrated database retrieval system