KEGG   Kluyveromyces lactis: KLLA0F06248gHelp
Entry
KLLA0F06248g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kla  Kluyveromyces lactis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KLLA0F06248g
   01230 Biosynthesis of amino acids
    KLLA0F06248g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLLA0F06248g
   00030 Pentose phosphate pathway
    KLLA0F06248g
   00051 Fructose and mannose metabolism
    KLLA0F06248g
   00052 Galactose metabolism
    KLLA0F06248g
  Energy metabolism
   00680 Methane metabolism
    KLLA0F06248g
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    KLLA0F06248g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KLLA0F06248g
Protein phosphatases and associated proteins [BR:kla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KLLA0F06248g
Messenger RNA biogenesis [BR:kla03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     KLLA0F06248g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:608680..611496
Genome map
AA seq 938 aa AA seqDB search
MTQSLPLLNGTEAYKLVTTQGLYDKTVKFYEKYLQLVHDKRVGTLTNSLITLKLVVDNSF
KPLDVVNDKDWRAIVSSALVFSCTNIQHFRDLAAGETIQAYPNETNPIEIYLKDPNGYII
GITETKNAISIKPTLPKQSVEASLISSRSSRIDIASSGVSTDSSYPAIPKTAKAQKSIAV
MTSGGDAPGMNANVRAIVRTAIFKGCNAFVVMEGYEGLVKGGPNYIKQVYWETVRNWSCE
GGTNIGTARCKEFREREGRLLGALHLIEAGVDALIVCGGDGSLTGADLFRSEWPSLIREL
LDQGRINKVQFDRYQHLNICGTVGSIDNDMSTTDATIGAYSALDRICQAIDYIEATANSH
SRAFVVEVMGRNCGWLALLAGISTSADYILIPEKPASSREWQDQMCDIISKHRSRGKRTT
IVIVAEGAISADLTPISSKDVHKVLVDRLGLDCRITTLGHVQRGGTAVAYDRILATLQGV
EAVNAVLESTPDTPSPLIAINENKITRKPLVESVQLTKSVAEAIHSKDFKKAMQLRDSEF
VEHLDNFMAINSADHIEPKLPEHTHMKIAIVNVGAPAGGMNSAVYSMATYCMSQGHKPYA
IYNGWTGLTRHESVRSLNWKDLLGWQSRGGSEIGTNRHTPEEADIGLIAYYFQKYGFDGI
IIVGGFEAFVSLHQLERARENYTAFRIPMVLIPATLSNNVPGTEYSLGSDTALNSLMQYC
DIIKQSAASTRGRVFVVDVQGGNSGYLATHAAVAVGAQVSYVPEEGISLEQLTQDIENLT
ESFSEAEGRGKFGQLILKSTNASKVLTPEVLAEVITQEAEGHFDAKCAIPGHVQQGGLPS
PIDRTRGTRFAIRAVGFIESQHKVLAAEANLDDDDFDFDTPKIIATASVLGVKGSDIVFS
SIRQLYDFETELNKRTPKTIHWQSTRTIADHLVGRKKL
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgacacaatctttgccattgttgaacggtacggaagcgtacaaattagttacgactcaa
gggttgtatgataagacagtcaagttttacgaaaagtatttgcaattagttcatgacaag
cgagttggcacattgacaaattctttaatcactctaaagctagttgttgataacagcttc
aagccattggatgttgttaacgataaagattggagggccattgtgtcatcagcattggtt
ttttcatgtacaaatatccaacatttcagagatttggctgctggtgaaacgattcaggcc
tatcctaacgaaaccaacccaattgaaatatatttgaaggatccaaacggatatatcatt
ggtatcactgaaacgaaaaatgctatttctatcaaacctacgctgcctaagcaatctgtt
gaggcctctttgatctcctcaagatcttcaagaatagacattgcttcttctggtgtttcc
actgacagctcgtatccagcgattccaaagactgcgaaagcgcaaaagtccatcgccgtt
atgacatccggtggtgatgcgccaggtatgaacgcaaatgtgagagctattgttagaaca
gctattttcaagggttgtaatgccttcgtagtcatggaaggttacgaaggtcttgtaaaa
ggtggtccaaattatatcaagcaggtttactgggaaacagtacgtaactggtcttgcgaa
ggtggtaccaacattggtactgctcgttgtaaagaatttagagagagagagggaaggtta
cttggtgctcttcacttaatcgaagctggtgtcgacgctttgatcgtgtgtggtggtgac
ggttccctcactggtgctgatttattcagatctgaatggccttctttgattcgtgaactc
ttagatcaaggaagaattaacaaagttcaattcgataggtaccagcacttgaatatttgt
ggtactgttggatccatcgataatgatatgtctactacagatgctaccattggtgcctac
tcggcattggatcgtatctgtcaagcaattgattacattgaggccaccgctaactcccat
tccagagcctttgtggtggaagttatgggtagaaattgtggttggttagctttattggct
ggtatctctacatcagctgattacatcttgattccagagaaacctgcatcatcaagagaa
tggcaagatcaaatgtgtgatatcatttcaaagcataggtcaagaggtaagagaacaact
atcgttattgttgctgaaggtgccatttcagcagacttaactcctatctcatctaaggac
gttcataaagtcttagtggacagattgggtctagattgtagaattactacactaggacat
gtccagagaggtggtacagccgttgcttatgaccgtattcttgcaacattgcaaggtgtg
gaagctgtcaatgcagttttggaatcaactccagataccccttctcctttgatcgctatc
aatgagaacaagatcactcgtaagcctttggttgaatcagttcaactaaccaaatctgtt
gcggaagcaatccattccaaggatttcaaaaaggctatgcaattgagagattcggaattt
gttgagcatttggataatttcatggcaatcaattctgctgaccatatcgaacctaagtta
ccagaacacacccatatgaagattgctattgtcaatgtcggtgccccagctggtggtatg
aactctgcagtttattcgatggctacgtactgtatgtctcaaggtcacaaaccatatgca
atttacaatggttggactgggttaactagacacgaatccgtgagatctctaaactggaag
gatcttttgggatggcaatcccgcggtggttctgaaatcggtaccaacagacatactcct
gaagaagctgatatcggtttgattgcttactatttccaaaagtatggattcgatggtatc
atcattgtcggtggttttgaagcgtttgtctccttgcatcaattggaaagagcaagagag
aactatacagccttcagaatcccaatggttttgattccagccactttatccaacaatgtt
ccgggtaccgagtactccctcggttcggataccgctctgaactctttgatgcaatactgt
gatattatcaagcaatctgctgcatcaacccgtggtagagtttttgttgttgatgttcaa
ggtggtaactctgggtatctagccacacatgccgctgttgctgtgggtgcccaagtttcc
tatgtcccagaagaaggtataagtttggagcaactaacgcaagatattgaaaacttgacg
gaatcattcagcgaagctgaaggtagaggtaaattcggacaacttatcttgaagtccacc
aatgcctctaaggtgcttactcctgaagtgttggctgaggtcattactcaagaagctgaa
ggtcacttcgatgccaaatgtgccatcccaggtcatgtccaacaaggtggtctaccttct
ccaattgatagaacaaggggtactagattcgccatcagagctgttggtttcattgagtct
caacacaaggtattagcagctgaggcaaatctggatgatgacgacttcgactttgataca
ccaaagatcatagcaactgcatcagtcttaggtgttaagggatctgacattgtctttagt
tcaatcagacaattgtacgattttgaaactgaattgaacaagagaaccccaaagactatt
cactggcaatcgactagaaccattgcggaccatcttgtaggaagaaaaaagctatga

DBGET integrated database retrieval system