KEGG   Kluyveromyces lactis: KLLA0F06732gHelp
Entry
KLLA0F06732g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
kla  Kluyveromyces lactis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    KLLA0F06732g
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KLLA0F06732g
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     KLLA0F06732g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(649269..649754)
Genome map
AA seq 161 aa AA seqDB search
MSKFYELAPKDKKGEPFPFTQLEGKVVLIVNVASKCGFTPQYKELEALYKKYEDKGFIVL
GFPCNQFGHQEPGTDEEISQFCQLNYGVSFPILKKVDVNGSEADPVYDFLKNEKSGLLGF
KGIKWNFEKFLVDKKGTVVERYSSLTKPSSLEEPIEKLLNE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagttttacgaattagcaccaaaggacaaaaagggcgaaccattcccattcact
cagctagaaggtaaagttgttttaattgtcaacgttgcttccaagtgcgggttcactcct
caatataaggaactagaagctttgtacaagaagtacgaggataaagggttcattgtgttg
ggtttcccatgtaaccagtttggacatcaagagccaggtactgatgaagagatttctcag
ttctgtcaactaaactacggtgtttctttcccaatcttgaagaaggttgatgtgaacggt
tctgaagctgacccagtctacgacttcttgaagaacgaaaaatccggattgttgggtttc
aagggtatcaaatggaactttgaaaaattccttgttgacaagaagggtaccgttgttgaa
aggtacagttctttgactaagccatcttcgttagaagaacctattgaaaaattgttgaat
gaataa

DBGET integrated database retrieval system