KEGG   Kluyveromyces lactis: KLLA0F06732gHelp
Entry
KLLA0F06732g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
kla  Kluyveromyces lactis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:kla00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:kla00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(649269..649754)
Genome map
AA seq 161 aa AA seqDB search
MSKFYELAPKDKKGEPFPFTQLEGKVVLIVNVASKCGFTPQYKELEALYKKYEDKGFIVL
GFPCNQFGHQEPGTDEEISQFCQLNYGVSFPILKKVDVNGSEADPVYDFLKNEKSGLLGF
KGIKWNFEKFLVDKKGTVVERYSSLTKPSSLEEPIEKLLNE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagttttacgaattagcaccaaaggacaaaaagggcgaaccattcccattcact
cagctagaaggtaaagttgttttaattgtcaacgttgcttccaagtgcgggttcactcct
caatataaggaactagaagctttgtacaagaagtacgaggataaagggttcattgtgttg
ggtttcccatgtaaccagtttggacatcaagagccaggtactgatgaagagatttctcag
ttctgtcaactaaactacggtgtttctttcccaatcttgaagaaggttgatgtgaacggt
tctgaagctgacccagtctacgacttcttgaagaacgaaaaatccggattgttgggtttc
aagggtatcaaatggaactttgaaaaattccttgttgacaagaagggtaccgttgttgaa
aggtacagttctttgactaagccatcttcgttagaagaacctattgaaaaattgttgaat
gaataa

DBGET integrated database retrieval system