KEGG   Kluyveromyces lactis: KLLA0F09273gHelp
Entry
KLLA0F09273g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
kla  Kluyveromyces lactis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KLLA0F09273g
Enzymes [BR:kla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     KLLA0F09273g
Exosome [BR:kla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KLLA0F09273g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:858627..859655
Genome map
AA seq 342 aa AA seqDB search
MVHVARFLDERPTDIPSILAGGYNHPLLREWQNERQLTKNMFIFPLFVSDQDDEETIIPS
LPNIKRFGINRLKDYVAGLVAKGLRSVILFGVPLKDGAKDQVATSADDPEGPVIQAIKLL
RKEFPDLYIICDVCLCEYTSHGHCGVLYEDGTINREKSVQRIAAVAVNYAIAGAHCVAPS
DMIDGRIREIKMGLIEHGLAHKTFVMSYSAKFSGNLYGPFRDAACSQPGKGDRKCYQLPS
GGRGLARRALKRDLQEGSDGIIVKPSTFYLDVMSDAAEICRDLPVCAYHVSGEYAMLHAA
AEKGVVDLKSIAFESHYGFLRAGARLIISYFTPEFLEWLDEN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggtccatgttgctagattcttggacgaacgtcctaccgatattccttctattcttgcc
ggtggttataaccatcctttattgagagaatggcagaatgagagacagttaacaaagaat
atgttcatcttcccgttgttcgttagtgatcaggatgatgaggaaactattataccatca
ttgccaaatatcaagagatttggtattaacagattaaaagattatgtcgccgggttggtt
gccaagggtctacgttctgttattttattcggagtgcctttgaaggacggagctaaggac
caagttgctacttctgctgatgatccagaaggacctgtaatccaagctatcaagttactt
cgtaaagaattccctgatttgtacattatctgcgatgtttgtttgtgtgaatacactagc
catggccattgtggtgtcttgtatgaagatggcaccattaacagagaaaaatcggttcaa
agaattgctgccgttgctgtcaattatgccattgctggtgctcattgtgtggcgccaagt
gatatgattgatggtaggatcagagagattaagatgggattgatcgagcatggattggct
cataagacctttgtgatgagttattccgctaaattcagtggtaacttgtatggtccattc
agagatgccgcttgttctcaaccaggaaaaggtgatcgtaagtgctatcaattgccttca
ggaggtcgtggcctagctagacgtgctttaaagagagatttgcaagaaggatcagatggt
atcatcgtcaaaccttctactttctatttggatgtgatgtccgatgcagctgaaatctgt
cgcgacctcccagtgtgtgcttaccatgtcagtggtgaatacgctatgttacatgctgct
gcagagaagggtgttgttgatttgaaaagtattgcctttgaatcgcactatgggttcctc
agagctggtgctcgcttaatcatcagttacttcactccagaatttttggaatggcttgac
gaaaattga

DBGET integrated database retrieval system