KEGG   Kluyveromyces lactis: KLLA0F09735gHelp
Entry
KLLA0F09735g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K05546  
alpha 1,3-glucosidase [EC:3.2.1.84]
Organism
kla  Kluyveromyces lactis
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycan precursor trimming
N-glycan biosynthesis, high-mannose type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:kla00510]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:kla04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(895086..897818)
Genome map
AA seq 910 aa AA seqDB search
MKLSLSTLLRWLLSFGIALAFQDDLLKKCSQSGFCHRNRQYAKNIQESRNSHYSLDQGSL
EFDTNNHTIQGFIIKSIKANQKDIKIPLPFTLDLFDGDKVRFRLDEHRSIKLGKAGINLQ
RYNETEHWAFDPDYIPIRQEVIAKSPTFWNKKDFTFTADRFTVTLSSQDFQINVKYDSAD
VLTVNSDNMLNFEHYRTLEENFENINEEEEPFNMFKDSFADSKSDSIPLGPESVALDFKF
HGISNLYGIAEHADSLRLRDTSNIDPYRLYNVDVFQYKLNSTLPMYGSIPFVVGIKESLS
IGLFWMNPSDTWIDIQYGHSDSSTHWMSESGIIDFIVIVQETPKLVTESYVNITGKPMLP
LLSSVGYHQCRWNYNDEKDVLTVDSLMDKWQIPYDFLWLDLEYTDQKQYFTWKPDAFPNP
TRMLSKLAFLGRNLVTLIDPHIKSNYHISEAIIAAKVYVRNALNKPFFGQCWPGESIWID
TFNPLASKLWSKFVQTFISTPSNLYIWNDMNEPSIFDGPETTAPKDLLHYNGFEERSVHN
LYGLTVHQATYDSFVDMNPNKRPFVLTRSFFSGSQRTAATWTGDNVANWEYLQLSIPMVL
SHNIVGMPATGADIAGFFGNPDDELLIRWYQAGIWYPFFRAHAHIDTRRREPFLLNERTR
SVVTEFIRLRYQLLPTLYTAFHDSHSRGIPIMNPMIYEHPNVANFYDIDDQFYLGEQGIL
VKPVTSANTKSIPITFPSGVFYDLQNLEIAHFGTLETKTVSAPLEKLPAYIAGGHIITRK
DQYRRSSRLMQNDPYTLVIAPTAYGTAKGRLYVDDGETFAYKQGKLLEVELEYNKNVIYG
TVLHKDTSSFFNDISIEKIVIAHHPDGKVAETCTLELDDIRTNIEVIHEDHSHVIKNPGI
QIGQDWKIIL
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgaagctatcactatctacattactacgttggttactaagttttgggatagcattagca
tttcaagatgacttgctaaaaaaatgctctcaatcaggattctgtcatagaaacagacaa
tacgctaaaaacatccaagaaagcaggaacagtcattatagtctcgatcaaggcagcttg
gaatttgatacaaataatcatactatacagggttttattatcaagagcataaaagctaac
caaaaagatatcaagatacctcttccttttaccttggatttatttgacggcgataaagta
agatttaggttagatgagcatagaagcattaaactaggtaaagctggtatcaatttacaa
aggtacaatgagactgaacattgggcatttgatccggactacatacctatcagacaagag
gttattgcaaagtcacccaccttttggaataaaaaggacttcactttcacggccgatagg
ttcacagtaacgttgagttctcaagacttccaaataaacgtcaaatatgactcggcagat
gttctaacggtaaacagcgataatatgctaaattttgaacattatagaacgttagaagaa
aatttcgagaacatcaacgaagaagaagagcccttcaacatgtttaaagatagctttgcg
gactcaaaatctgattcaatcccgcttggtcctgaatcagtagccttagactttaagttt
catggtatatctaatctttatggtatcgcagaacatgcagattctttgagactacgtgac
acatcaaacattgacccttatcgtctttacaatgttgatgtttttcagtataagttgaat
tccacattgcctatgtatggttctatccccttcgttgttgggataaaagagtcactgtcg
atcggactgttttggatgaacccatctgatacctggattgatatccaatacggacacagc
gactcttccactcattggatgtcagaatcaggtatcattgatttcattgtaattgttcag
gaaacaccaaaacttgttacagagtcatatgttaatattacaggaaaaccaatgcttcct
ttactttcttcagttggataccaccagtgtagatggaattacaatgatgaaaaggatgtg
ctcaccgtggattctctgatggataaatggcagataccctacgactttttatggttagat
ttagagtacacagaccagaagcaatattttacctggaagccagatgcttttccgaatcca
actagaatgctctcaaaattagctttcttaggaaggaatttggttacactcattgatccg
catataaaatcaaactatcatattagcgaagccataatagccgctaaagtatatgtgcga
aacgctttgaacaaaccgttttttggccaatgttggcctggggaatccatttggattgat
actttcaatccattagcaagcaaactttggtcaaaatttgtacaaacttttatttctacg
ccatcgaacctctatatatggaatgatatgaacgagccttcgatattcgatgggccggaa
actacagccccaaaggatcttcttcattataatggattcgaagaaaggtcagtgcataac
ttgtatggactaactgttcaccaggccacctatgattcctttgttgatatgaacccgaac
aaaagaccgttcgtcttgactagatcgttcttttctggatcgcaaagaaccgcagctaca
tggaccggtgacaatgtagctaactgggaatacttgcaattgtccataccgatggtattg
agtcataacattgtcggaatgcctgcaactggagctgatatagctggctttttcggaaac
ccagatgacgagctattgatccgttggtatcaggctggtatatggtatccatttttcaga
gcccacgcacatatagacaccagaagacgagaaccatttttattgaacgagcgaacaagg
tcagttgtaactgaatttatcagactcaggtatcaactactaccgacgctatacacagcc
tttcacgattcacattcaagaggaattcccattatgaatccaatgatctatgaacatcca
aatgtggcaaatttctacgacattgatgaccaattctatttgggtgaacagggcatattg
gtgaagcctgtcacttctgctaataccaaatctatccccatcacattccctagtggagtc
ttctatgatttacaaaatctagaaatcgcacatttcggaactttggaaactaagactgtt
tctgcaccattggagaaacttccagcgtacatagcaggcggtcatattatcaccagaaaa
gatcaatatcgtagatcatcacgattgatgcaaaatgatccctacacgctcgtgatagca
ccaacagcatatggtactgctaaaggaaggctatatgtcgatgatggggagacatttgct
tacaaacaagggaaacttttggaggtcgagctggaatataacaaaaacgttatatatggg
acagtattacataaggatacttcatctttcttcaatgacatttctattgagaaaattgtt
atcgctcatcatcccgatggaaaagttgcggagacgtgtactttagagctggacgatatt
agaacaaatatcgaagttattcatgaagatcacagtcacgttatcaagaaccctggtatt
caaataggacaggactggaaaatcattctatag

DBGET integrated database retrieval system