KEGG   Kluyveromyces lactis: KLLA0F09911gHelp
Entry
KLLA0F09911g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
kla  Kluyveromyces lactis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:kla00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    KLLA0F09911g
Exosome [BR:kla04147]
 Exosomal proteins
  Proteins found in most exosomes
   KLLA0F09911g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(911305..916269)
Genome map
AA seq 1654 aa AA seqDB search
MSDLPIEFTELVDLTSLGISPQYLDFRSTTFESDHFVTVRESSNGTNTVAIVDLTNGNEV
TRKNMGGDSAIMHPSQKVISVRANGTIVQIFNLDTKSKLKSFQLDEPVIFWKWLSEDVLG
FITANSLYVSNVFDGNVSAKPAKITDRHVNLNNTQIINFVANEKMDWFAVVGIIQENGKI
AGKIQLFSKTRGISQAIDGHVAIFSKILLDGNTEPVQVFVTGNRNVNTGAGELRIIEIDP
PQDQSVRYQKKIVDIFFPADAVNDFPISVQVSEKYGIIYVLTKYGFIHLYELETGSNLFV
NRITADSVFTATYYNHKNGIACINKKGNVLAVEIDTTQIVPYVLNKLSNVSLALTMASRG
GLPGADDLFEKQFDNLLSQGDYSNAAKVAASSQQLRTQATINKLKNIQAPPGSISPILLY
FSTLLDKGKLNQYESIELTRPLLQQNRNQLYEKYLKEDKLQCSEELGDIVKPFDTTLALA
TYLKAEVHPKVIACLAELQQFDKILPYSAKVGYNPNFVVLISNLLRTNPDKASEFAISLL
SNPETASQLEVEKIADIFFSQNYIQQGTSFLLDALRSNTPDQGHLQTRVLEINLLNAPQV
ADAILGNDIFSYYDKPTIAGLAEKAGLYQRALENYSDIKDIKRCIVHTSSIPADWLVDFF
GKLNVEQSLACLKTLLDDNLEANLQIVIQVATKFSDLIGSQVLIKLFEDYRSNEGLYYYL
ASLVNLTTDKEVVFKYIQAAVKAGHFQEVERIVRENNVYDPEKVKNFLKDAQLQDQMPLV
VVCDRFNMVHDLVLYLYRTKNFKFIEVYVQQVNPSKTAQVVAGLLDVDCDEKVITSLLDT
VVGQVPIDELTAEVEKRNRLKLLLPFLEKTLQSGTQNQSVYNTLAKIYIDSNNSPEKFLK
ENDQYDTLNVGRYCEKRDPYLAYIAYEKGQNDDDLIRITNENSMYKYQARYLLARSNSDL
WNIVLSPDNIHRRQLVDAVISVGIPELTDPEPVSLTVQAFMSNGLKTELIELLEKIILEP
SPFNDNPALQGLLLLSAIRYEPNKVSGLIEKLDHYDVDEIAPLCIENELNEEAFEIYDKH
GKHDKALKVIVEDLLMLDRAESYADKINTPELWSQLGTAELNALRIPEAIDSYIKAKDPS
NFMNVIKAAEDAGKFEELVPYLLMARESLKEPVIDGALILAYAELSKLNEIENLLSVSTV
ANLEEVGDKLSQHNDYKAAKLCYSSISNYSKLASTLVYLGDYQNAVDTARKASNVKVWRQ
VNDACISNKEFRLAQICGLNLVVHAEELDELVAVYEHNGYFEELISLFEAGLGLERAHMG
MFTELAILYTKYNPSKTYEHLKLFWSRINIPKVIRAVEDAHLWPELIFLYAHYDEWDNAA
LTMIEKSAYNFDHSYFKEIIVKVSNLEIYYKAINFYVKEHPSLLVDLLTVLIPRLDIPRT
VRIFSKSDNLPLIKPFLINVLPKNNSVVNQAYHDLMIEEVDYKALQDAVSSYDKFDQLEL
ATRLENHEIIFFKIIAAELYRRNKKWAKSLAIFKGEQLWKHAIETAAISQSQQIAEDLLS
FFIETDNKEGFIALLYSCYHLITYDTVLEQAWLNNLETFIKPYEISVKKEQNDAIKQLSS
EFASKAKVGSNSDDQPLLLTNGAIGSQATGFSNY
NT seq 4965 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcttcccatcgaatttactgaattggtagatctaacatcactaggtatctcc
cctcaatacctagatttcagatctaccactttcgaatccgatcatttcgtcaccgttaga
gagtcctccaacggtacaaacacggtggcaattgtcgatttgacaaacggcaatgaggtc
acaaggaaaaatatgggtggtgactctgccatcatgcatccttcacaaaaagttatctct
gttagagctaacggaaccatcgttcaaatcttcaacttggatactaagtccaaattgaaa
tctttccaattggatgaaccagttattttctggaaatggttgagcgaagacgtgttagga
ttcatcactgctaactcactttacgtctccaatgtgtttgatggaaacgtttctgctaag
ccagccaaaattactgatagacacgttaacttaaacaacacccaaattatcaactttgtc
gccaatgaaaaaatggactggttcgctgtcgttggtatcattcaagaaaatggtaaaatt
gctggtaaaattcaattgttttcgaaaactagaggcatctcgcaagccattgatggtcac
gtagctatcttctccaaaattcttttggatggtaacacggaacccgttcaagtcttcgtt
acaggtaacagaaacgtcaacacaggcgctggcgaattgcgtataattgaaatcgatcca
cctcaagaccagtcagtaagataccagaaaaaaattgtagatatattctttccagctgat
gcagttaacgatttcccaatttctgttcaagtctctgagaagtacggcatcatttatgtt
ttgaccaagtacggttttatccatttatatgagttagagactggttcaaacttgttcgtc
aatagaatcactgcggactctgtctttactgcaacatactacaaccacaagaatggtatc
gcatgtatcaacaaaaagggtaacgttttggctgttgaaattgatactactcaaatagtt
ccttacgttttgaataagttgtccaatgtatccctcgcattgacaatggcttcgagaggt
ggactaccaggtgctgatgatttattcgagaagcaattcgacaaccttttatcacaaggc
gattacagcaatgctgctaaagttgctgcgtcatcccagcaattaagaactcaagctaca
attaacaagttgaaaaatatccaggcacctccaggatcaatctctccaattttactatat
ttctccacattgttggataagggcaaactaaatcaatatgagtctattgaattgacaaga
ccacttctacaacaaaatagaaatcaattatacgaaaagtacttaaaggaagacaaatta
caatgctctgaagaattaggtgacatcgtgaagccatttgatactactttggctttggca
acctatttgaaggcggaagtacatccaaaggtaattgcatgtcttgcagaattgcaacag
ttcgataagattttaccatactccgccaaggtgggatacaatccaaacttcgttgttttg
atttctaacctattaagaactaaccccgacaaagcaagtgagtttgccatcagtttatta
tctaaccctgaaactgcttctcaacttgaagttgaaaagattgccgacatattcttcagt
cagaattacattcaacaaggtacttctttcttacttgacgctttaagatcaaatactcct
gatcaaggacatttgcaaacgagagtattggaaatcaacttattaaatgcccctcaagtt
gctgatgctattttgggtaatgacattttctcttattatgataagccaactattgcaggt
ttggcagaaaaggcaggtttataccaaagggccttggaaaactactctgatattaaggat
atcaagagatgtattgtccatacttcctccattccagctgattggttagtggacttcttc
ggtaagttgaatgtcgaacaatcactcgcctgtttgaagaccttgttagatgataatttg
gaagcaaatcttcaaattgtcattcaagttgcaaccaagttctcggatttgattggttct
caagtattaatcaaactcttcgaagattatagatcaaacgaaggtttatattactacttg
gcttctttagtaaacttgactaccgataaggaagttgttttcaagtatattcaagctgct
gtcaaagctggtcacttccaagaagttgaaagaattgtaagggaaaacaacgtttatgac
ccagagaaggtcaagaatttcttgaaagatgcccaactacaagatcaaatgcctttggtt
gttgtttgcgatcgtttcaacatggtgcatgacttggttttatacttgtacagaaccaaa
aacttcaaatttatcgaagtgtacgtgcaacaagttaatccttctaaaactgctcaagtt
gtggcaggtttattggatgttgattgtgacgagaaagttatcacctcattgttagatact
gtcgtcggtcaagttcctatcgatgaattgactgctgaagtcgagaagagaaacagattg
aagttactattaccattcctcgaaaagactttacaatctgggactcaaaatcagtctgtc
tacaacaccttagctaagatctacattgactcaaacaactcacctgaaaagttcttgaag
gagaatgatcaatatgatactttgaatgttggtcgctattgtgaaaagagggacccttac
ttggcgtacatcgcctacgagaaaggacaaaacgatgatgatttgattagaatcacaaac
gaaaatagtatgtacaaatatcaggccagatatttgttggctcgttcaaactctgatttg
tggaacattgtgttgtctcctgacaatatccatagacgtcaattggttgatgctgtcatt
agcgttggcattcctgagcttactgatccagaaccagtgtctttgactgtgcaggctttt
atgtctaacggattaaagacggagttaattgaattgttagagaagattatcctagagcca
tctcctttcaatgacaatcctgctttgcaaggtttattgcttctctctgctattagatat
gaacctaacaaggtaagtggcttaattgagaaattagatcattatgatgttgatgaaatt
gcaccattgtgtattgaaaatgaattaaatgaagaagccttcgaaatttatgataaacat
gggaaacatgacaaagcattgaaagttatagtcgaagatcttttgatgttagacagagca
gaatcatatgccgacaaaatcaacacaccagagctatggtctcaacttggtactgcagaa
ttaaatgcattacgtatcccagaagctattgactcttacatcaaggctaaagatccttcg
aacttcatgaacgttatcaaggctgccgaagacgctggtaaatttgaagagcttgtccca
tatttgttgatggctagagaatctttgaaggaaccggtaatcgacggagcattaatcttg
gcatacgctgaattgagtaagttgaatgaaattgaaaacttgttgtcagtctctaccgtt
gctaacctagaagaagttggtgataagttatcccagcataatgattacaaagctgccaaa
ttatgttactcttctatttctaactactctaagttggctagcactttagtttatttgggt
gattatcaaaatgctgtcgataccgccagaaaagcttccaatgttaaggtgtggagacag
gttaacgacgcatgtatttccaataaagaatttagattggctcaaatctgtggtttgaat
ttggttgttcatgccgaggagttagacgaattggttgctgtatatgagcacaacgggtat
ttcgaggagctaatttccctattcgaagcaggtttaggtttggaaagagctcatatgggt
atgtttactgaattggcaatcctttacactaagtacaatccatccaagacttatgaacac
ctaaagctattctggtctcgtattaacattccaaaagtcataagggctgtagaggatgct
catttatggccagaattgatctttttgtatgcacactacgatgaatgggataatgctgct
ttaacgatgattgaaaagtctgcctataactttgaccattcgtacttcaaagaaatcatt
gttaaagtgtcaaacttggaaatttactacaaagcaatcaacttttatgtgaaggaacac
ccttcactacttgttgatttattaaccgtgttgattccaagattagacattccaagaact
gttagaattttctccaaatctgacaatctaccattgattaaaccattcttaattaatgtc
ttgccaaaaaacaactccgtagttaatcaggcttatcacgatttgatgatcgaagaggtt
gattacaaagctcttcaagacgctgttagctcgtatgataagtttgatcaactagagttg
gccacccgtttggaaaatcatgagataattttcttcaagattattgctgccgaattgtac
cgtagaaacaaaaagtgggccaagagtttggctatcttcaagggcgaacagctctggaaa
catgctattgaaactgctgcaatttcacaaagtcaacagatcgccgaagacctattatca
ttcttcattgaaaccgacaacaaagaaggatttatcgctttactatattcttgttaccac
ttgattacatacgatactgtccttgaacaagcttggttgaataacttggaaacatttatt
aaaccatatgaaatttctgtgaagaaggagcaaaatgatgcgatcaagcaattaagttcc
gagtttgcatcaaaggcaaaagtaggctctaactccgatgaccagccattacttttgaca
aatggcgcgattggctcacaggcaactgggttttctaactactga

DBGET integrated database retrieval system