KEGG   Kluyveromyces lactis: KLLA0F09999gHelp
Entry
KLLA0F09999g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K01288  
carboxypeptidase D [EC:3.4.16.6]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.6  carboxypeptidase D
     KLLA0F09999g
Peptidases [BR:kla01002]
 Serine Peptidases
  Family S10
   KLLA0F09999g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
F:complement(923413..925341)
Genome map
AA seq 642 aa AA seqDB search
MSLWLFFVQTVLLIQCALGGLPNAKDYLVAPDLLPGLNDVKDKELIPEMHAGHIPLDDGD
DDDDDDEKNYFFWKFHDLANQTSVVASKTLIIWLNGGPGCSSLDGALMESGALRIDDDGE
AYLNPGSWHTRGDIVFVDQPAGTGFSTVGDSKYDKDLNQVSKHFMKFLKNYFKIFPDDLD
KDLVLAGESYAGQYIPFFANEILKFNSKLDKDDNEEESRSGKKYNLKSLLIGNGWIDPDQ
QSLSYIPFALENNLISTKADYFPDLLNMHSRCQNLVNNNGGKKFSFDECEDILTKILYYT
RRKTDENGNKVPSNQECTNIYDFRLFDSYPACGSNWPDDLPSVSKFLGKPGVMDSLHLDV
DKVPHWRECDSKVSSHLKNKNTQPSIHLLPNLLKHMQIFLFNGDKDIICNSRGVQDLIKN
MKWNNHTGFTNDAEYYDWQYYDQFTDDTISAGFVKHESNLTYVSVYNASHMVPYDNALIS
RGIMDIYLKDVELVVGKDNQDDVIISKDFVVHSDHSTGEEELSADQKQDEDENSHKDRHR
NSDKFEIAVILLVVFSITGTIAYYFLRERFRKQIHAILIDPENRPPSSNKSVAWADDIEN
QGDDFKLSIDEAPSTADKPAKNKSGYTKVPNTDDDSFELDNL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttggcttttctttgttcaaacggttcttctcattcaatgtgcattgggaggt
cttccaaatgccaaggactatttagtggcccccgatttgttgcctgggttaaatgacgtt
aaagataaggaacttatcccggaaatgcatgcaggtcatattcccttagatgatggtgat
gatgatgatgatgatgatgagaaaaactatttcttttggaagttccatgacctcgcaaat
cagacgtctgtcgtcgcatccaaaactttaattatatggttaaatggtgggcctggatgc
tcatctttagatggggctcttatggaatcaggtgcgttacggatcgatgacgacggcgaa
gcctatttaaatccgggttcttggcacactagaggtgatattgtgtttgtggatcaacct
gctggtactggcttttccacggtaggtgattcgaaatatgataaagatttgaaccaagtt
tcaaagcatttcatgaagtttttaaagaactacttcaagattttccctgatgatttggat
aaagaccttgttttggcaggagaatcgtatgctggtcagtatattccattctttgctaat
gaaatcctaaagttcaactcgaaattggacaaagacgacaatgaggaggaaagccgaagt
ggtaagaagtacaatttaaagagtctgttgattggaaatggttggattgatcctgatcaa
caatccttatcttacattccttttgctttggagaataacttaatttcaacgaaggctgat
tacttccctgatttattaaatatgcatagtcgttgtcaaaatttagtcaataataatgga
ggtaaaaagttctcctttgatgaatgtgaagatattttgaccaaaatcctttattacacc
cgcagaaagacagatgaaaatgggaataaagttccttcaaatcaggagtgtacgaacata
tatgattttagattattcgattcctacccagcttgtggaagcaactggccagatgattta
cctagcgtttctaaattcttgggtaagccaggtgtgatggattcgttacatttggatgtt
gataaagtcccacattggagagaatgtgacagtaaggtgagcagtcatttgaagaacaag
aacacccagccttcgattcatttgttacccaatctattgaaacacatgcaaattttcttg
ttcaatggtgataaggatatcatttgcaactcaaggggtgtgcaggatttgattaaaaat
atgaaatggaacaatcataccggatttactaatgatgccgaatactatgactggcaatac
tacgaccagtttacagatgacacaatttctgcaggttttgtgaagcacgaaagtaatttg
acgtatgtttccgtgtacaacgcatcgcatatggtcccttacgataatgctttaatcagc
agaggtattatggacatctatttgaaagatgtagagttagtagtcggaaaagacaatcaa
gatgatgttattatctcaaaagacttcgttgtacactcggaccactcaacaggagaagag
gaattgtcagctgatcaaaaacaagatgaagatgagaactcgcacaaggatagacaccgg
aactctgataaattcgaaatcgctgtcatacttctggtcgttttctcaattaccggtacc
attgcatattatttcttgcgtgaacgtttcagaaagcaaatacatgctattctaatagat
ccggaaaataggccaccttcatcaaacaaatccgttgcatgggcagatgacatagaaaac
cagggcgatgattttaagttatccattgacgaggcaccctctactgcggacaaaccagca
aaaaacaaatctggttatacaaaggtgcctaacactgatgacgattcattcgaacttgat
aacctataa

DBGET integrated database retrieval system