KEGG   Kluyveromyces lactis: KLLA0F11814gHelp
Entry
KLLA0F11814g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
kla  Kluyveromyces lactis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:kla03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(1089699..1092494)
Genome map
AA seq 931 aa AA seqDB search
MNHYVNKPFKRPRMVGRPGRDTLSEQIHTGLRPKSHHSHTKITNTSSETVKLTYAGPKSL
KTSVNAPVGVSKSSQEVSLFTANYRRVTNKKNKTWDGDGYANMTSDDKLKFYNEAGVSLG
SVPIKDRDLYETIWRIGSTEFQIDYRISDQEELSSVQDICKIKVSHTLGITDIPVAKKHK
ATIESKPPIQTFIPKITTKFKPLRKHLNGEPKVPPAQKQLVDQPTVKSALPPLSQELIGQ
ITYSPLFDPVSIKDPLIMNKTENHKVSVIVDPLLSKTLRPHQREGVKFLYDCVMNMVHTK
GDESMILERDDDIKGCLLADEMGLGKTLMTITLIWTLLKQTPYPTIINQRGVTLAGEISK
VLIVCPVTLIGNWKKEFKKWLPMNRIGVLTLHSRNSPTEDKAQVRSFLKVPRTYQVLIVG
YEKLLSIKDELQNEKRNLDLVICDEGHRLKNKDSKILKVLQSLDIEKKIVLSGTPIQNDL
EEFYTIIDFINPGILGSFGRFKREYILPIARSRDVNAKQNQTLVEQGLLRSDQLIEITKR
FILRRTNEILQQYLPPRTDLIIFCKPTAEQVEAFHKILTEGQLNFSNMTFNSSLGLITLF
KKICNSTRLIKTDPYYEERLSQVQTSSTSGKFTSGKLRILLSLLHELKTKTDEKVVVISN
YTQTLDIIEGHCSSEGYTSARLDGSTATKTRDQIVTSFNNDPSIFVFLLSAKSGGVGLNL
IGASRLVLFDNDWNPSIDLQAMSRIHRDGQRRPCFIYRLVTTGCIDEKILQRQLMKIALS
KKFLDSATDQSKNDDDLFQQEELKDLFTINLSTLSNTHDLICNCSGEVEVLEEEEITGTD
EANAQPEYQAAATPSNNPPASIWINALEAQKIIEKEEILRNGTKSEIMRKCLLGYKHIDP
QKTNDLIDEAMNNVFDDARQYITYALVKDSV
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgaatcattatgtcaataaacctttcaaacgtccacgcatggtaggtagacctggaaga
gataccctttctgagcagatacacaccggccttcggccaaagtctcatcattcacatact
aaaattaccaataccagctctgaaactgtgaaactaacgtatgccggcccaaaaagtttg
aaaaccagcgtaaatgcaccagttggtgtgtctaagtcatcacaggaggtttctttattt
acagcaaattacagaagggttacaaataagaagaacaagacgtgggatggtgatggatac
gccaatatgacaagcgacgataaattgaagttttacaacgaagctggtgtctctttagga
tcagttccaatcaaggatagggatttatatgagaccatatggagaatcggatctaccgag
tttcaaatcgattatagaataagcgatcaagaagaattaagctctgtgcaagacatatgt
aaaatcaaagtcagtcatacacttggaataacggatattccagtcgccaagaagcataaa
gcaaccatagaaagtaagccaccaatacagacattcataccgaaaataacgaccaaattc
aaacccctgagaaaacacctaaacggagagcctaaagtgcctccagcacagaaacaacta
gtagatcaaccaactgtcaaatctgctctaccaccgctgagtcaagaactaattgggcag
ataacttattcgccgttgtttgatccagtttccattaaagatccattgatcatgaacaaa
acggagaatcataaagtgagtgttattgttgacccgctattgtcgaagacactaagacca
caccagcgcgaaggtgtcaaatttctctatgactgcgtaatgaacatggtacatacaaaa
ggtgacgaaagcatgattctcgagagagatgatgacataaaaggatgtttactagcagat
gagatggggctcggaaagacgttgatgacaattacgctaatttggacactcttgaaacaa
acaccttatccgactataataaaccagagaggagtaactctcgctggagagatatcgaag
gtcctcattgtatgtcctgtcactttaatcggtaattggaagaaggagttcaaaaaatgg
ttgcctatgaatagaattggagtgttgaccttacacagtaggaactctccaacagaggat
aaggctcaagtgagaagcttcctaaaagttccccgaacttatcaggttttgattgttggt
tatgaaaaactcctcagtatcaaggatgaactacagaatgagaagagaaaccttgatctt
gttatctgtgatgaaggacatagattgaagaataaagattctaagatcttgaaggttttg
caatcattagatattgagaagaaaattgtattgagtgggacacctattcaaaatgatctt
gaagagttctatacaataattgattttatcaatcctgggattttaggatctttcggaagg
tttaaaagggaatatattttacctatcgccagatccagggatgtcaatgctaaacaaaat
caaactctggtagaacaaggacttctgagatccgatcaattaattgagataacgaaacgg
tttatcttaagaagaaccaatgaaattttacaacaatatttaccaccgagaactgatctc
attatattttgcaaacctaccgctgaacaagtagaggcttttcacaagattttaaccgaa
gggcagctaaatttcagcaacatgacattcaactcttcattggggttgattactctattc
aaaaaaatctgcaattccacccgcttgatcaaaacagatccatactatgaagaaaggctt
agtcaagttcagacttctagtacctctggaaaattcacctcggggaaacttagaatactt
ctttcattattacatgagttgaaaaccaagactgacgagaaagtagtagtgatttcaaat
tacacgcaaaccctagacatcattgagggacattgtagttcagaagggtacacttctgca
cgattagatggaagtacagcaaccaaaacccgtgatcagattgtgacatccttcaataat
gatccatctatttttgttttccttttaagtgcgaagtcaggcggtgtgggactaaactta
atcggtgcatcaagacttgtattattcgataatgattggaacccatccattgatttacag
gccatgtcaagaattcatcgcgatggtcagagaaggccatgtttcatttatagacttgtg
acaaccggatgtattgatgagaagatacttcaaagacagttaatgaaaatagcgctttct
aaaaagttcttggacagtgccacagatcaatcaaaaaatgatgatgatctttttcagcag
gaagagttgaaggacttgtttaccattaatttgtccactttatccaatacccacgactta
atttgtaattgttctggtgaagtagaagtgcttgaagaagaagagataacgggtactgat
gaagccaacgcccagccagaataccaggctgctgcgactccatcaaacaatcctcctgct
tcaatttggatcaatgctctagaagcccaaaaaattatagagaaggaggagatacttcga
aatggaacaaagtcagaaatcatgagaaaatgcctattgggatacaaacatattgatcca
caaaagactaatgacttaattgacgaagctatgaataacgtctttgatgatgcacgacag
tacatcacttatgctttggtaaaagactccgtgtaa

DBGET integrated database retrieval system