KEGG   Kluyveromyces lactis: KLLA0F12496gHelp
Entry
KLLA0F12496g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
kla  Kluyveromyces lactis
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:kla03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:kla04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1159546..1160481
Genome map
AA seq 311 aa AA seqDB search
MDQQSVDVDDIIDRLLEVRGLKPGHQVDLEEHEIRYLCSKARSIFIKQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCMHGGLSPDLN
TMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVSRFLQKQDM
ELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPASK
LLERNVVRRKK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggatcaacaatcagtagacgttgacgatatcattgatagattgttggaagtgagaggg
ttgaaacctggccatcaggttgacttggaagaacacgagattaggtatttatgttccaag
gccagatctattttcatcaagcagccaatcctattggaattggaggcaccaattaagatt
tgtggtgatatccacggtcaatattatgatttgttacgtcttttcgaatacggtgggttc
ccaccagaatccaactatctgtttttaggtgattatgtggatcgtggtaaacaatcgcta
gaaaccatttgtttactgttggcttacaagatcaagtatccggagaatttctttatcttg
cgtggtaatcacgaatgtgcatcgatcaatagaatttacgggttttacgacgaatgtaag
agacgttataacattaagctttggaaaacttttacggattgtttcaactgtttgcctatc
gctgcgattgtcgatgaaaaaatcttttgtatgcatggtggattatccccagatttaaat
accatggaacaaatcagacgtgtgatgagacccaccgatatcccagacgtggggttatta
tgcgatttgttatggtccgatccggataaagatatcgttggatggtcagaaaacgataga
ggtgtctcgttcacttttggtcctgacgtagtgagtaggtttttacaaaaacaagatatg
gaattgatctgtagagcacatcaagtcgtcgaagacggatacgagtttttcagtaaaaga
caattggtaacattgttcagtgctccaaactactgtggtgagttcgataacgctggtgct
atgatgtctgttgatgaaagtttattatgttcgttccaaatcttgaaaccagcttctaag
ttattggaacgaaacgtagtgagaagaaagaaatga

DBGET integrated database retrieval system