KEGG   Kluyveromyces lactis: KLLA0F16929gHelp
Entry
KLLA0F16929g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
kla  Kluyveromyces lactis
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:kla00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(1558278..1558610)
Genome map
AA seq 110 aa AA seqDB search
MPAPYKKGSEKKGATLFKTRCLQCHTVEAGGPHKVGPNLHGVFGRHSGKASGYSYTDANI
KKNVLWDEQTMSDYLENPKKYIPGTKMAFGGLKKEKDRNDIVTYMLKACK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccatacaagaagggttccgaaaagaagggtgctactttgttcaagaccaga
tgtttgcaatgtcacaccgttgaagccggtggtccacacaaggtcggtccaaatttgcat
ggtgtcttcggtagacactctggtaaagcttccggttactcttacactgacgctaacatc
aagaagaacgtcttgtgggatgaacaaactatgtctgactacttggaaaacccaaagaag
tacattccaggtaccaagatggctttcggtggtttgaagaaggaaaaggacagaaacgat
atcgttacttacatgttgaaggcttgtaaataa

DBGET integrated database retrieval system