KEGG   Kluyveromyces lactis: KLLA0F17457gHelp
Entry
KLLA0F17457g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     KLLA0F17457g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1600261..1601220
Genome map
AA seq 319 aa AA seqDB search
MVPKPDKHNSSTEDEEIYGILDKPNIRHVQFGLNKRFATWYGSNVYFGRNKRTLGFKESN
NEHTAKQSPTEKKFEDQYWIDTLYVCEYCFKYTDDEAELIAHECFCRYKNKPPGRIKYRS
PEYTIRRVKGSKHEVFCQCLCLFTKLFLDNKSVYFKVKHFEFYIVYENNSTVPMAFFSKD
LYSYHQNNLACILVFPPYQRRRLGTLLIEFSYTLSRCQGLISGPEVPLSPFGLIGYLKFW
SFSIVWQLTEGNLKDVAQVTLKDLSEATGFRINDIIQALKYLDCLSDSEIRLNIIRSWAR
RNKVSHGFMIKDEYLLLDD
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggttcccaaacctgataagcacaacagctcaacagaggatgaagaaatatatggtatt
cttgacaagcctaatattaggcacgtccaatttggcttgaataaaagatttgcaacttgg
tacgggagtaatgtttattttggaagaaataagaggaccttgggcttcaaggaatcgaac
aatgagcacaccgcaaaacaaagccctactgaaaagaagtttgaagatcagtattggatt
gataccctatacgtatgtgaatattgtttcaagtacactgatgatgaagcagagttaatc
gcacatgagtgcttttgccgatataagaataagccacccggtagaataaaatacagaagc
cccgaatacactatacgaagggtaaaaggttctaagcatgaagttttctgccaatgctta
tgtctatttactaagctatttcttgataacaagtctgtctacttcaaagttaagcatttc
gaattctatattgtgtatgagaacaattctacagtaccgatggcatttttttcaaaagac
ttatattcctaccaccaaaataaccttgcatgtattcttgtctttccgccctatcaaaga
agaagattgggtactctcttgattgagttttcctacactttatcaagatgtcagggtctg
atttcgggtcctgaagttcctctatctcctttcggtttaattggctatcttaaattttgg
tctttctcaatagtttggcagttgactgaaggtaatttgaaagatgtggcccaggtcact
ttgaaggatctttccgaggccactggttttagaatcaatgatataattcaagctctcaaa
tatcttgattgtttaagtgattctgaaataagactcaatatcatccgttcatgggcaaga
cgcaacaaggtatcccatggatttatgatcaaagatgaatatctactacttgatgattaa

DBGET integrated database retrieval system