KEGG   Kluyveromyces lactis: KLLA0F18678gHelp
Entry
KLLA0F18678g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
kla  Kluyveromyces lactis
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KLLA0F18678g
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KLLA0F18678g
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KLLA0F18678g
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KLLA0F18678g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     KLLA0F18678g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1716890..1718404
Genome map
AA seq 504 aa AA seqDB search
MLRHSYCRAQQQSLRHVLKTRLAVNQLRFMSEVKFRVDSTARVVTLDRPKKLNALDVEMC
SAILPTLQEYAKSTVNNVVILNSSASPRAFCSGGDVAQVAKLVKEGNFDYAREFFTKEYS
LNLALATLNKPVISIMDGITMGGGVGLSTHIPFRIATENTRWAMPEMDIGFFPDVGATFS
IPKLTTVGGSNGQLAQYLCMTGDILNGADAYVAGVASHYVPHDQISNLQARLAELHLTEA
TSQSTNRDDEIFDVVNHAIEEFNAPLPRDYKFKYTADELNVIEQCFDIGNSLKQIYSKLD
EVIAGKTVSQTAQEFAAKTKQMLASKSPVSLEIAKELFQRNSFTDIQTALTQDLITATKM
SESPDLCEFAEATSHKLLEKNKTPYQWKIKDLKLAQISVLISQNSSNPVSLIRPSNLVTF
SEYPHHSKYQLPNETLVEKYITGADNHGRQTAVTKKEAVKFFQQLNPATKSKTGVDYLVG
FIIDRKCVPNPDGFLRWKTSSAKL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggcattcctattgtagagcacagcaacagtcattgagacacgttttgaagacc
agattggctgttaatcaattaagatttatgtctgaagttaagtttagagtcgattccact
gccagagtggtcactttggatagaccaaagaaattgaacgcattggatgttgagatgtgc
agtgccatcttgcccacattgcaagaatatgccaagagtaccgttaacaatgttgttatc
ttgaactcttcagctagtcctagggccttctgttcaggtggcgatgtagctcaagtagcc
aagttggttaaggaaggaaattttgattacgctagagaatttttcaccaaggaatactcg
ttaaacttggctctagctacgctgaacaagccggtcatctctatcatggacggtatcacc
atgggtggtggtgtcggtctatctactcatattccattccgtattgctactgaaaatact
cgttgggccatgcctgagatggatattggattcttcccagatgtcggtgccactttctct
attccaaagcttaccactgttggtggttccaacggacaattggctcagtacttgtgcatg
actggtgacattttgaatggtgccgatgcttacgtggctggtgtcgcttctcattatgtg
ccacatgatcagatctccaacttacaggcaagattggctgagttacatttgactgaagcc
acttctcaatcgactaaccgtgatgatgaaattttcgatgttgtcaaccatgctattgag
gaattcaacgcaccattaccaagagactacaagttcaagtacactgctgatgaactaaac
gtcattgaacagtgtttcgatatcggtaacagtttgaagcaaatctactccaaattggat
gaggtcattgctggaaagacagtatcacaaacagctcaggagtttgctgcaaagaccaag
caaatgctagctagcaaatcccctgtttctttggaaatcgcaaaagaacttttccaaaga
aactccttcactgacattcaaaccgccttgacccaagatttgatcactgctactaaaatg
tcagaatctccggacctatgtgaatttgctgaggccactagtcataaattgctagaaaag
aacaagaccccataccaatggaagatcaaagatttgaaattagcccaaatatcagttcta
atctcacaaaactcctcaaacccggtgtcgttgatccgcccatcaaatttagttactttc
tctgaatacccacatcatagcaagtaccaattaccaaacgaaactctagttgagaaatat
atcacaggtgctgacaaccatggaagacaaactgcagttactaagaaggaagctgtcaaa
ttcttccaacaattgaaccccgccacgaagagtaagaccggcgtagactacttggtaggt
tttattattgacagaaaatgtgttccaaacccagatggtttcttaagatggaaaacttcc
tctgctaaactataa

DBGET integrated database retrieval system