KEGG   Kluyveromyces lactis: KLLA0F18832gHelp
Entry
KLLA0F18832g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kla  Kluyveromyces lactis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KLLA0F18832g
   01230 Biosynthesis of amino acids
    KLLA0F18832g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLLA0F18832g
   00051 Fructose and mannose metabolism
    KLLA0F18832g
   00562 Inositol phosphate metabolism
    KLLA0F18832g
Enzymes [BR:kla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KLLA0F18832g
Exosome [BR:kla04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KLLA0F18832g
  Exosomal proteins of bladder cancer cells
   KLLA0F18832g
  Exosomal proteins of melanoma cells
   KLLA0F18832g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1729736..1730482
Genome map
AA seq 248 aa AA seqDB search
MARTFFIGGNFKMNGSKASIKEIVDRLNGASIPSNVEVVIAPPAIYLDHAVALNKRKEVK
ISAQNAYSKASGAYTGENSVEQIKDVGAEWVILGHSERRTYFNETDEIVAEKTKFALDSG
VKVILCIGETLEEKQQNITLQVVQRQLQAVLEKVQDWTNVVVAYEPVWAIGTGLAATAED
AQDIHHSIREFLAEKLSRDVADSVRILYGGSANGKNAVTFKDKADVDGFLVGGASLKPEF
VDIINSRV
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctagaacattcttcattggtggtaacttcaagatgaacggaagcaaggcttccatc
aaggaaatcgttgacagattgaatggagcttccatcccatctaacgtcgaagtggttatc
gctccaccagctatctacttggaccacgctgttgcattaaacaagagaaaggaagttaaa
atctctgctcaaaatgcatactccaaggcttccggtgcttacactggtgaaaactccgtt
gaacaaatcaaggatgtcggtgctgaatgggttatcttgggtcactctgaaagaagaact
tacttcaacgaaactgatgaaatcgtcgccgaaaaaaccaaatttgctttggacagcggt
gtcaaggttatcctatgtatcggtgaaactttggaagaaaagcaacaaaacatcactcta
caagtcgtccaaagacaattgcaagccgtattggaaaaggttcaagactggactaacgta
gtcgttgcctacgaaccagtctgggctattggtaccggtttggctgctactgctgaagat
gctcaagatatccaccactccatcagagaattcttggctgaaaagctatccagagatgtc
gctgactctgttagaatcttgtacggtggttctgctaacggtaagaacgctgttaccttc
aaggacaaggctgatgtcgatggtttcttggtcggtggtgcttctttgaagccagaattc
gttgacatcatcaactccagagtttaa

DBGET integrated database retrieval system