KEGG   Kluyveromyces lactis: KLLA0F18832gHelp
Entry
KLLA0F18832g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kla  Kluyveromyces lactis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KLLA0F18832g
   01230 Biosynthesis of amino acids
    KLLA0F18832g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLLA0F18832g
   00051 Fructose and mannose metabolism
    KLLA0F18832g
   00562 Inositol phosphate metabolism
    KLLA0F18832g
Enzymes [BR:kla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KLLA0F18832g
Exosome [BR:kla04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KLLA0F18832g
  Exosomal proteins of bladder cancer cells
   KLLA0F18832g
  Exosomal proteins of melanoma cells
   KLLA0F18832g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1729736..1730482
Genome map
AA seq 248 aa AA seqDB search
MARTFFIGGNFKMNGSKASIKEIVDRLNGASIPSNVEVVIAPPAIYLDHAVALNKRKEVK
ISAQNAYSKASGAYTGENSVEQIKDVGAEWVILGHSERRTYFNETDEIVAEKTKFALDSG
VKVILCIGETLEEKQQNITLQVVQRQLQAVLEKVQDWTNVVVAYEPVWAIGTGLAATAED
AQDIHHSIREFLAEKLSRDVADSVRILYGGSANGKNAVTFKDKADVDGFLVGGASLKPEF
VDIINSRV
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctagaacattcttcattggtggtaacttcaagatgaacggaagcaaggcttccatc
aaggaaatcgttgacagattgaatggagcttccatcccatctaacgtcgaagtggttatc
gctccaccagctatctacttggaccacgctgttgcattaaacaagagaaaggaagttaaa
atctctgctcaaaatgcatactccaaggcttccggtgcttacactggtgaaaactccgtt
gaacaaatcaaggatgtcggtgctgaatgggttatcttgggtcactctgaaagaagaact
tacttcaacgaaactgatgaaatcgtcgccgaaaaaaccaaatttgctttggacagcggt
gtcaaggttatcctatgtatcggtgaaactttggaagaaaagcaacaaaacatcactcta
caagtcgtccaaagacaattgcaagccgtattggaaaaggttcaagactggactaacgta
gtcgttgcctacgaaccagtctgggctattggtaccggtttggctgctactgctgaagat
gctcaagatatccaccactccatcagagaattcttggctgaaaagctatccagagatgtc
gctgactctgttagaatcttgtacggtggttctgctaacggtaagaacgctgttaccttc
aaggacaaggctgatgtcgatggtttcttggtcggtggtgcttctttgaagccagaattc
gttgacatcatcaactccagagtttaa

DBGET integrated database retrieval system