KEGG   Kluyveromyces lactis: KLLA0F20053gHelp
Entry
KLLA0F20053g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
kla  Kluyveromyces lactis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:kla00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    KLLA0F20053g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     KLLA0F20053g
Protein kinases [BR:kla01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   KLLA0F20053g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1867209..1868543
Genome map
AA seq 444 aa AA seqDB search
MSNEEFIRTQIFGTVFEITNRYTNLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTS
VLAKRTYRELKLLKHLRHENLICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEKQFV
QYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRY
YRAPEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVI
DTICSENTLKFVTSLPHRDPVPFSSRFQNLEPDAIDLLEKMLVFDPKKRITAADALAHPY
LSPYHDPTDEPIAEAKFDWNFNDADLPVDTWRVMMYSEILDFHQIGDPQINTNATFDDQV
AAATVAAAEAASKQQQQQQHQTEEQTQQTIASTPPQAQVTPQQLESGANSNSNSNPSFSI
GPDPANETLTNFANQADQYVSKFK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgaggaatttattaggactcaaatttttggtacagttttcgaaattaccaat
cggtatactaatttgaacccggttggtatgggtgccttcgggttggtttgttctgctaca
gatacgctaacaagccagcctgtagcgattaagaagattatgaaaccgttttctacttcc
gtactggcaaaaagaacgtatagggaactcaaattgttaaagcatctaaggcatgagaat
ttgatttgtctcgaagatatcttcttgtcaccattagaagatatttatttcgtcactgaa
ttgcaagggacggatctacatagattgttgcagacaaggcctttggaaaaacaattcgtt
caatatttcttataccagatcttgagggggcttaaatacgttcattccgcaggtgtgatc
catagagatttgaaaccttccaatatcttgatcaatgagaactgtgatttaaagatctgc
gatttcggacttgctaggattcaagatcctcaaatgactggttacgtgtcaacccgttac
tatagagccccagaaatcatgttgacctggcaaaaatataatgttgaagtagacatctgg
tctgctggttgtatctttgccgaaatgatcgagggtaagcctttgttcccaggtaaagat
cacgtgcatcaattttctatcatcactgatctattaggatcgcctccaaaagatgtcata
gacactatttgctcagagaacactctcaaatttgttacttcattacctcatagagatcct
gtaccattcagttcgaggttccagaacttggaaccagatgctatagatcttctagaaaaa
atgcttgtgttcgatccaaagaagagaattacagcagctgatgccttggcccatccttac
ctttccccatatcatgacccaaccgacgaacctatcgcagaagctaagtttgattggaat
ttcaacgatgctgacttacctgttgacacctggcgtgtaatgatgtattccgagatcttg
gatttccatcaaatcggtgacccacaaatcaatacaaatgctactttcgacgaccaagta
gccgctgccactgtcgccgccgcggaggctgcctctaagcaacagcagcagcaacaacac
caaactgaagagcaaactcaacagacaatcgcctctactcctccccaggctcaagtgacc
ccacaacaacttgaaagtggcgctaactctaattccaattctaacccttctttctctatt
ggccctgatccagcaaacgaaacattgacgaattttgctaatcaagcagaccaatacgtc
tccaaattcaaataa

DBGET integrated database retrieval system