KEGG   Kluyveromyces lactis: KLLA0F20504gHelp
Entry
KLLA0F20504g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
kla  Kluyveromyces lactis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    KLLA0F20504g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     KLLA0F20504g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(1902726..1904429)
Genome map
AA seq 567 aa AA seqDB search
MSKLSRKYHLPYTRAIIGENGLLIKDQFTSGPSTSSSTLLARRSNGGDFGDDEDDEDGDA
SGSFQSSVFETASLISCVTCLSDTESKDENEALLLPSNTVIPYAKILDVTNMEAEDDGSP
WPDHTALIEVTFAKPRRNHLVPKTIKLSVDTSVFPNMGTDVAEEILNRSYKNTKRNKSIL
VIINPHGGKGKANKLFLSKAKPILLASGCKIVVKETTYHLHAVDIAKNLDIDEYDVVACA
SGDGIPHEIMNGLFLRSDRAKAFQKLAITQLPCGSGNAMSISCHGTSNPSYAALALLKSV
ESRIDVMCCTQPSYKNQPRLSFLSQTYGIIAESDIDTEFIRFIGPARFELGVTMNVLQRK
KYPCDIYFKYAAKTKNELKDHYLQHKDRLNNLRNDLESSSTFTLDIPRSGKESNLDDITI
TDDSFKLRWPFEDDVPSDWERIDPELTRNTGIFYTGKMPYIAPDTKFFPAALPDDGTMDF
VLTDGRTPLTRIAPILMSLNRGSHVLQPEVEHSKILAFRLVPYAKNSVISVDGENFPYET
LQVEVLPKLVKTLLKNGSYVETDFESM
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagctgagcaggaagtatcatttgccctatacaagagccatcattggcgaaaat
ggtttattgattaaagatcaatttacgtccggtccttcaacaagctcatcgacgcttttg
gcacgcagaagtaatggaggtgatttcggcgatgacgaggatgacgaagacggcgatgct
tctgggagcttccaatctagtgtttttgaaacagcttcgttaatcagttgtgttacttgt
ctcagcgacacggaatctaaagatgagaatgaagctctgctgctaccttcaaatacggtt
attccttacgcaaagattcttgatgtcacgaatatggaagcagaagatgatggttcccca
tggccggatcatactgcattgattgaagtcacttttgcaaagccaaggaggaaccattta
gtcccaaaaacaataaaattgagcgtcgatacttcagtgtttcctaatatgggaactgat
gtggcagaagagatcttgaatagaagttataaaaacactaagagaaacaaatcaattcta
gtcattatcaacccacacggtggtaagggtaaagccaataaattgttcttgtccaaagcc
aaaccaatattattagcaagtggttgcaaaatcgttgttaaagagacaacatatcatttg
catgctgtcgacattgcaaaaaatttggatatagatgaatacgacgtagttgcatgtgct
tctggtgatggtatcccccacgaaattatgaatggtttgtttttaagatcagatcgtgct
aaagcattccagaagctagccattactcaattaccttgtggttcaggtaatgcaatgagt
atatcttgccatggtaccagtaatccatcgtatgccgcattggctctccttaaatctgtc
gaatcgagaatagatgtcatgtgttgtactcaaccgtcctataaaaatcaacctagattg
tcattcttaagtcaaacgtatggaatcatcgcagaatctgatattgatacggagttcatc
agatttattggaccagcaaggtttgaacttggtgtcactatgaatgttttacaaagaaag
aaatatccgtgtgacatatatttcaaatacgctgccaagacgaaaaatgaactaaaagat
cattatttgcaacataaggatagattgaataatctacggaatgatttagaatctagttct
acgtttacactcgatatccctagatctggtaaagagtcaaacttggacgatataacaatt
accgatgactccttcaaactcagatggccgtttgaagatgacgtaccgtcagattgggaa
agaattgatcctgaactaacgcgtaacacagggattttctatactggtaagatgccttac
attgcgcctgatacaaaattcttcccagctgccttgccggatgacggtaccatggatttc
gttctaacagacggacgtacgccattaacgagaattgccccaattttaatgtcattgaat
agagggtcacatgtcttacagcctgaagtggaacattctaaaattttggctttcaggtta
gtcccatatgcaaagaatagcgttatttctgttgatggagaaaatttcccgtacgagaca
ttgcaagtagaagttcttcctaaacttgtaaaaaccttgttgaaaaacggtagttacgta
gaaaccgactttgagtccatgtaa

DBGET integrated database retrieval system