KEGG   Kluyveromyces lactis: KLLA0F21978gHelp
Entry
KLLA0F21978g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
kla  Kluyveromyces lactis
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:kla00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:2042656..2044929
Genome map
AA seq 757 aa AA seqDB search
MVSKSSGFLPNSSDLRLRERKAQFDGTEVLEDFLRDNEPVEDKLVKPLKSSIFSNRNHRF
HTYVCLLLTLVSFVLRFYKIDRSNIVVWDEAHFGKFGSYYLKHEFYHDVHPPLGKMLIGL
GEYLAGFDGNFDFSSNSSYPDEVNFKIMRQFNAIFSSLCTPLAFYAARNLNFSMPTVYLV
ALMVCFEHSYIVLGKFVLLDSMLLFFTVLTFYCLSQLYRLRECQLTVKWLAWILATGFSI
GCVCSVKWVGLLITALVGIYTVSELYCLHCDRSLSKTKYLGHWIVRISALIVFPLILYMV
FFKIHFTLLYKTGTGDSSTHSLFQANLEGAQIKPSPRDIAFGSCISLRSHGLSPGLLHSH
PQTYPDGSNQRQVTGYSYRDGNNNWIVKYSRSSGKASAEERVYSDNILFLKDGDLLRLVH
EKTKNNLHTHQIPSHVSKGHYEVSGYGNDAVGDLKDDWIIEVVEQLPTGNNTMENKALIH
PLTTSFRLRNKELGCYLAATGLSYPGWGYNQAEIVCKYPWNQRDKSTWWNVEDHINSNLH
IDQTFTPPPTKFWTDFVVINFAMAASNNALIPDLDKYDRIASEPWEWPILYKGLRMCNWN
DKTVKYYLLGSPFNTWLSTAALPILLILVSMELFRYQRQSLQLNEKKAWNLFACAGLSFI
GWLLHYAPFFIMGRVTYIHHYVPALFFAIMTFAYVVDFALANSNRYLKVVAYSSLYAGCT
FTYWYFAPFCQGMPEPNLTYVNLELLPSWDVTNAQYN
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atggtttctaaatcatctggatttttaccgaactcttcagacttgcgattgagagaaaga
aaagcacaattcgatggtacagaggttttagaggacttcttaagagataatgaacctgta
gaggataagctggtgaagccattgaaatcttcaatattttccaacagaaaccaccgattt
cacacatatgtttgcttattactaacactggtatctttcgtgcttcggttctacaagatt
gacagaagcaacatcgttgtctgggacgaggctcattttgggaaatttggatcatattat
ttaaagcatgagttctaccatgatgtgcatccaccattgggcaagatgttgataggttta
ggtgaatacctcgcgggatttgatggtaactttgactttagttccaactctagttatccc
gatgaggtaaatttcaagattatgaggcaattcaatgctatatttagctcactgtgcaca
cccttagcattctatgcagccaggaatcttaattttagtatgccaaccgtttatctcgta
gccttaatggtttgtttcgaacactcatatattgttttgggtaaattcgtgctattggat
tccatgttactgttctttactgttcttaccttctattgtttatcgcagctttataggtta
agagagtgtcaacttactgtgaaatggctggcttggattctggccactggtttctccatt
ggatgcgtatgttcagtcaagtgggttggtcttctaatcacagctctagtgggcatttac
acggtgtcagaattatactgtctacattgcgatagatcattatccaagactaaatacctt
gggcattggatagtgagaatttcggccttaatcgtctttcctttgattctttacatggtt
ttcttcaaaattcattttactctgctttataaaactggcactggagattcatctacgcat
agtctgttccaagctaatcttgaaggagctcaaataaagccgagccctagagatatagca
tttggatcgtgtatctctctaagatctcatggtttaagtcctgggttattacattcacat
ccacaaacttatcctgatggatccaatcaaagacaggtgacgggttacagctatcgtgat
ggaaataacaattggattgtcaaatattctagatcgtcgggaaaggcgagcgcagaagaa
agggtttacagcgataacattttattccttaaagatggtgacttattgcgattggttcat
gaaaaaaccaaaaacaatttgcacacgcatcagatcccttctcatgtttctaaagggcat
tatgaagtatcaggctatggtaatgatgctgtaggcgatcttaaggacgactggattatt
gaggttgtcgaacagttaccaactggaaataacacaatggaaaataaagccctgattcat
cccctcaccactagttttagattgagaaacaaggagctcggctgttacttggcagccact
ggtctatcatatcctggttggggttacaatcaagcagaaatcgtttgcaaatatccatgg
aaccagcgtgacaaatccacctggtggaatgtcgaggatcacataaattctaatctgcac
attgaccaaactttcactccacctccaacaaagttttggaccgactttgtggttataaac
tttgctatggcagcatcaaataatgccttgataccagatctggataaatacgacagaatt
gcaagtgaaccatgggaatggcctattctctacaaagggttacgtatgtgcaattggaat
gataaaaccgtgaagtattaccttctcggttcacctttcaatacttggctgtctacggct
gctttgcctatattgttaatcttagtctctatggaactctttaggtatcaacgccaatca
ctccagttaaacgaaaaaaaagcatggaatttatttgcttgtgcaggattatcattcatt
ggttggctacttcattacgctccattttttatcatgggaagagtaacatacatacatcat
tatgtccctgccttgtttttcgcaattatgactttcgcctatgttgtcgacttcgcactg
gctaattcgaacaggtacctaaaagtagttgcatattcgtctctgtacgcggggtgtacc
tttacttattggtattttgctccattctgtcagggtatgccggagccaaatttaacatat
gttaatcttgaattacttcctagttgggatgtaacgaacgcgcagtacaattaa

DBGET integrated database retrieval system