KEGG   Kluyveromyces lactis: KLLA0F22242gHelp
Entry
KLLA0F22242g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
kla  Kluyveromyces lactis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:kla00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(2079462..2080118)
Genome map
AA seq 218 aa AA seqDB search
MGARALLVIDIQNDFLPPKGSLAVQDGDTIIDPVIQLLQDQDWDCVAMTKDWHPPDHISF
AKNHGLPDFSSFTYDSPVPGSTEKQSATLWPVHCVQETWGSEVPEKLLAEILKLKVPHKI
VNKGYLSDREYYSGFNDIWNDHHTELDAFFKENDVTEIYVVGLAFDFCVKNSAISAANLG
YHVTILKDYTKAIANDLQSIESFIQELAKNEVSVQESI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgggagcccgtgcgttattagtaattgatattcagaacgatttcttaccaccaaaagga
tcattggcagttcaagatggtgatactatcatcgatcctgtcatccagcttttgcaagat
caggattgggactgtgttgccatgactaaagactggcatccgccagaccacatttctttt
gcaaagaaccatggattaccagatttcagttcattcacctacgactcacccgttcctggg
agcaccgagaaacaaagtgctacgttatggccagtccattgtgtccaggagacatggggc
tctgaggttccggaaaaattactcgctgaaattttaaagctcaaggtgccacataagatt
gtcaataaaggttacttatcggatcgtgagtattattccggattcaacgatatctggaat
gatcatcacactgaacttgacgcctttttcaaagagaatgatgttactgaaatctatgtg
gtcggacttgcattcgatttctgcgtaaaaaactcagcaataagcgctgcaaaccttggt
taccatgtaactatactcaaggattatactaaagctatcgcaaatgatttgcaatcgatt
gaatcgttcatccaggaattggccaaaaatgaggtctcagttcaagagtccatctga

DBGET integrated database retrieval system