KEGG   Kluyveromyces lactis: KLLA0F22242gHelp
Entry
KLLA0F22242g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
kla  Kluyveromyces lactis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KLLA0F22242g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     KLLA0F22242g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(2079462..2080118)
Genome map
AA seq 218 aa AA seqDB search
MGARALLVIDIQNDFLPPKGSLAVQDGDTIIDPVIQLLQDQDWDCVAMTKDWHPPDHISF
AKNHGLPDFSSFTYDSPVPGSTEKQSATLWPVHCVQETWGSEVPEKLLAEILKLKVPHKI
VNKGYLSDREYYSGFNDIWNDHHTELDAFFKENDVTEIYVVGLAFDFCVKNSAISAANLG
YHVTILKDYTKAIANDLQSIESFIQELAKNEVSVQESI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgggagcccgtgcgttattagtaattgatattcagaacgatttcttaccaccaaaagga
tcattggcagttcaagatggtgatactatcatcgatcctgtcatccagcttttgcaagat
caggattgggactgtgttgccatgactaaagactggcatccgccagaccacatttctttt
gcaaagaaccatggattaccagatttcagttcattcacctacgactcacccgttcctggg
agcaccgagaaacaaagtgctacgttatggccagtccattgtgtccaggagacatggggc
tctgaggttccggaaaaattactcgctgaaattttaaagctcaaggtgccacataagatt
gtcaataaaggttacttatcggatcgtgagtattattccggattcaacgatatctggaat
gatcatcacactgaacttgacgcctttttcaaagagaatgatgttactgaaatctatgtg
gtcggacttgcattcgatttctgcgtaaaaaactcagcaataagcgctgcaaaccttggt
taccatgtaactatactcaaggattatactaaagctatcgcaaatgatttgcaatcgatt
gaatcgttcatccaggaattggccaaaaatgaggtctcagttcaagagtccatctga

DBGET integrated database retrieval system