KEGG   Kluyveromyces lactis: KLLA0F22297gHelp
Entry
KLLA0F22297g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     KLLA0F22297g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(2083448..2085547)
Genome map
AA seq 699 aa AA seqDB search
MTMASKNFAAKRKRTRTLEGINESSTLRSQYMDGHMSDPIMTAAAAAAAAAAADVSTSSA
SNTGRMQNPFIEEFMSSNNDPMTADSLRGTLLLDVDRQGQNSGSFVTGIAANNRNSKQNE
NGNGFDLVDLDDSAVEFVNSVNYTSAKKVKKQRTVSLPQLPHARLLYEPRNTDRRTQNDD
ELLHVSGTTTQTVDGNKLIKLPLIRSLSPVPVADFRLGKNGGMQNNNQDQNFDISNSASK
SPSRFTKILKKSPLLGSHQDKLRSMDRFKTDEEGHYVYQENDIFAKNRFQAMQLLGQGTF
GKVVKCKDYLNDITVAVKIIRAVDRYRQAAKTELRVLQTIKENDRSGQYQCLLLREFFDY
KNHICLVTDLYGRSVYDFMTNNGYARFPGSHVQAIGKQLVRSVCFLHDLGIIHTDLKPEN
ILICDETCVEQSLPMEIIDSLTERRKLASGGKRKILINPEVKLIDFGSAVFYNEYHPPVV
STRHYRAPEIVLGLGWSFPCDIWSIACVLVELVTGESLYPIHENTEHMAMMQRINNEKFP
KKMVEKMFFKVENKYGSIPTDLQTSVVKYFDRQTGELRWPLRNSKGQVITKEKSWKRILA
TCDRLDVFISKKLQMDYGSWLEIHWDMQLEDNWRLILSKNIDSRNIDKNVFMFWYYFVDL
CRKMFEFDPTKRITAKEVIEHEWFNIGILDEGISHYGRL
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgacgatggcctcaaagaattttgctgccaagaggaaaagaaccaggactttggaaggc
attaatgaaagctcgacactgagatcacaatatatggatggacacatgtcagatcctata
atgacggcagctgcggccgcagccgcagccgcagctgcagatgtctcaacgtcttctgct
tcaaatactggacggatgcagaatccgttcatcgaggaatttatgtcatccaacaacgat
ccaatgacggcagattcgttaaggggcacgcttctgttggatgttgacagacagggccag
aattcaggatcttttgttaccggtatcgctgctaataataggaatagtaaacaaaatgaa
aacgggaacggatttgatcttgtagatttggacgacagtgccgtggagtttgtcaatagt
gtcaactatacgagtgccaaaaaggtaaagaagcaaagaacagtctctttaccacaatta
ccgcatgcaagactactctacgaacccagaaatacggataggaggacacagaatgatgac
gagttattgcatgtcagcggtactacgacgcaaactgttgatgggaacaagttgattaaa
ttgccattgatcagatctttgtctccggtacctgttgctgatttcagattgggaaaaaat
ggtggtatgcaaaacaataaccaggaccagaactttgacatctcaaattctgcctcgaaa
tctccatccaggttcaccaaaattttaaagaaatctccgctattgggctcccatcaggac
aaattacgttctatggatagattcaaaactgatgaggaaggtcattatgtataccaggag
aatgacatttttgccaagaacagattccaggctatgcagcttttgggacagggtactttt
gggaaagtggtaaagtgcaaggactatttaaacgatatcactgttgctgtcaaaatcata
agagctgtcgatagatatcggcaagctgcaaagacagaactacgtgtcttgcagactata
aaggaaaatgacaggagtggccaatatcaatgcttgctgttgcgagaattcttcgattac
aagaatcacatatgcttggtcactgatttatacggcaggtccgtgtatgactttatgaca
aacaatggatatgcaaggttccctggttcccatgttcaagctatcggtaaacagttggta
cgttctgtgtgcttcttgcatgatttaggaataatacatactgatttgaaaccggagaat
atattgatatgtgatgaaacttgcgtggaacagtcacttccaatggaaatcatagactct
ttaactgaaagaaggaaactggctagcggtggaaagagaaaaatactcataaatcctgag
gtgaaattaattgattttggaagtgctgtattctacaatgaataccatccacctgtcgtt
tcaacgcgtcactacagagctcctgaaattgttttagggcttggatggtctttcccatgc
gatatctggtcaatagcatgtgtattggttgagctagttactggcgagtcactctatcca
attcatgaaaatacagagcatatggctatgatgcaacgtatcaacaatgaaaaattccct
aaaaagatggttgaaaaaatgttcttcaaagttgaaaacaagtatggcagcatcccaact
gatttgcaaacttcagttgtaaaatatttcgacagacaaacaggagaattaaggtggcct
ctccggaattcaaaaggtcaagtcattaccaaagaaaagtcatggaaaagaattttggca
acatgtgacaggctggatgtttttatctccaaaaagttacaaatggactatggatcttgg
ctggagattcactgggatatgcagttagaggacaactggcgtctaattttatcaaaaaat
attgattccagaaatattgataagaacgttttcatgttttggtattatttcgttgattta
tgtcgtaagatgtttgaatttgatccaacgaaaagaataacggcgaaggaagtgattgaa
catgagtggttcaacattgggattttagatgaaggtatttcacactacggaagattatag

DBGET integrated database retrieval system