KEGG   Kluyveromyces lactis: KLLA0F23133gHelp
Entry
KLLA0F23133g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
kla  Kluyveromyces lactis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KLLA0F23133g
Enzymes [BR:kla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     KLLA0F23133g
Glycosyltransferases [BR:kla01003]
 Polysaccharide
  Storage polysaccharide
   KLLA0F23133g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:2154515..2156623
Genome map
AA seq 702 aa AA seqDB search
MTRDIVNHLVFEVATEVANKVGGIYSVLKSKAPITCKQYGPKYLLLGPLNPQSVQVEVEP
VDWEDESNFHIKEVQWSLRSMHNRGVRFTYGRWLIDGAPMVILFDLNSVRNYLNEWKADL
WEIAGIPSPDGDFETNDAILLGYTVAWFLGELAHMNQTNAIVAHFHEWLAGVAIPLCRKR
RIDVVTIFTTHATLLGRYLCAGNVDFYNNLDKFDVDAEAGKRGIYHRYCIERAAAHSADV
FTTVSQITAYESEYLLKRKPDGILPNGLNVIKFQAVHEFQNLHALKKEKINDFIRGHFHG
QFDFDLEKTLYFFIAGRYEYRNKGADMFIESLARLNHRLKASGSKMTVVAFIIMPAKNKS
YTVDELRGQAVVRQLENSVKDVTQLIGKRIFEHAMRYPHNGTKTEIPTSLDELFKPSDKV
VLKKRVFALRRPEGTLPPIVTHNMVDDANDPILNQIRRVQLFNNSYDRVKIIFHPEFLNA
NNPILSLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGAYMEDLIEK
DQAKDYGIYIVDRRFKNPNESVEQLVDYMEDFVNKTRRQRINQRNRTERLSDLLDWRRMG
LEYVKARQLALRRAYPDEFKELTGGTDLDDSNMDSLAGNPKVKVARPLSVPGSPRDSRAS
SVGAVMMTPGDLGTLQDANNADDYFHLSMGDNEDDEDEDQFN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtgatattgtgaaccatttggtgttcgaagtggcgactgaggttgctaataag
gtgggtggtatttattcggtgttgaaatcgaaggctcctatcacttgcaaacagtacggt
cctaaatatttactgctgggaccattgaacccacaatccgtgcaagttgaagtggaaccc
gtggattgggaagacgaatccaacttccatattaaagaggttcaatggtctcttagatct
atgcataaccgtggtgtccgcttcacttacggtagatggttgattgatggtgctccaatg
gttattcttttcgatttgaactctgttagaaattatttgaatgaatggaaggcggattta
tgggaaatcgccggtatcccatcccctgatggtgattttgaaaccaacgatgccatctta
ttgggttatactgtggcatggttccttggtgaattggcccatatgaaccagacaaatgcc
atcgtggcacatttccacgaatggttggctggtgttgctatcccgttgtgcagaaaacgt
aggattgatgtggtcaccattttcactactcatgccactttgttgggtagatacctatgt
gccggcaatgtggatttctacaataatctcgacaagtttgacgtggatgcagaggctggc
aaacgtggtatctatcatcgttattgtatcgaacgtgcggcagctcatagcgctgacgtt
ttcactactgtttcacagattactgcatacgaaagtgaataccttttgaaacggaaacct
gatgggatcttaccaaatgggctaaatgtcatcaaattccaagccgtccatgaattccaa
aatttacatgcattgaagaaggagaaaattaacgacttcatcagaggtcatttccatggt
cagttcgatttcgatcttgaaaaaactttgtacttcttcattgcaggtcgttatgaatac
cgtaacaagggtgctgatatgttcattgaatcattggcaagattgaaccacagattgaag
gcatctggatctaaaatgactgttgtcgccttcatcatcatgcccgcaaaaaataaatca
tacacagtcgatgagctacgcggccaagctgtggtcaggcaactggaaaactcagtgaaa
gatgtcacacaattgatcggtaagagaatctttgaacacgccatgagatatcctcataat
ggcaccaaaactgaaattccaactagccttgacgaacttttcaaaccaagtgataaagtt
gtattgaaaaaacgtgtatttgcattgcgtagaccagaaggtactttacctcctattgtt
actcacaacatggtggatgatgccaatgatcctattttgaaccagatcagacgtgttcaa
ttgttcaataattcatatgaccgtgtcaagatcattttccatccagaatttttaaacgcc
aacaatccaatcttgtctcttgactatgacgaatttgtgagaggttgccatttgggtgtg
tttccctcatattacgaaccatggggctacacaccagcagaatgtaccgtcatgggtatc
ccatcaattactactaatttgtctggtttcggtgcttatatggaagatttgattgaaaag
gaccaagccaaggattatggtatttatatcgtggaccgtcgtttcaagaatcctaacgaa
tctgtagaacagttggttgattacatggaagatttcgtgaacaaaacacgtagacaaaga
atcaaccaaagaaacagaactgaacgtctttcagatttgttagactggagacgtatgggt
cttgaatatgtcaaggcaagacaacttgccttgcgcagagcttatcctgacgaatttaaa
gaattaactggtggtaccgatttagatgattcaaatatggattcattggccggtaatcca
aaggttaaagttgccagaccattgagtgttccaggatctcctagggattcaagagctagc
agtgtgggtgctgtaatgatgactccaggtgatttaggtactttacaggatgccaacaat
gctgatgattacttccatctatctatgggcgataacgaggatgacgaagatgaagaccaa
ttcaactaa

DBGET integrated database retrieval system