KEGG   Kluyveromyces lactis: KLLA0F23914gHelp
Entry
KLLA0F23914g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
kla  Kluyveromyces lactis
Pathway
kla00620  Pyruvate metabolism
kla00630  Glyoxylate and dicarboxylate metabolism
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
kla01200  Carbon metabolism
Module
kla_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KLLA0F23914g
   00630 Glyoxylate and dicarboxylate metabolism
    KLLA0F23914g
Enzymes [BR:kla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KLLA0F23914g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase DNA_pol3_tau_5
Motif
Other DBs
NCBI-GeneID: 2895299
NCBI-ProteinID: XP_456145
UniProt: Q6CIU4
Position
F:complement(2232014..2233681)
Genome map
AA seq 555 aa AA seqDB search
MVKKNLENVQLLVDVDTKPQFSPSTTTVADILTKDALEFVVLLHRTFNKTRLQLLENRQI
VQQKIDSGEYEFNFLKETEAIRNDPTWQGPPLAPGLIDRSTEITGPPLRNMLVNALNSDV
KTYMTDFEDSASPTWVNVIYGQVNLYDAIRDQIDFVTPRKEYKLRGKIADLPTLIVRPRG
WHMVDNHILVDGEPISASILDFGLYFYHNAKKLIEIGKGPYFYLPKMEHHLEAKLWNDVF
QVAQDSLAIPRGTIRATVLIETLPAAFQMEEIIWQLRQHSSGLNCGRWDYIFSTIKRLRN
KPEHVLPNRDQVTMTSPFMNAYVKRLIKICHGRGVHAMGGMAAQIPIKDNEEANNAAMTK
VRNDKIRELTNGHDGSWVAHPALAAICNEVFAEMGTPNQIYFVPETSVAASDLLNTNIEG
GEITTAGIKQNLDIGLQYMEAWLRGSGCVPINNLMEDAATAEVSRCQLHQWVKHKIVLKD
TGKQVTPALAKEILYQQAKELAAKSPVGDANKFELAATYFEPEITGEKFSEFLTTLLYEE
IITVNSTPYDLSKLK
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaaaaaatttagaaaatgttcaacttttagttgatgtcgataccaaacctcaa
ttctctccaagcaccactaccgttgccgatatcttgactaaagatgctttggaatttgtc
gttctattgcatagaactttcaacaagaccagattacaattactagagaacagacaaatt
gttcaacaaaagatcgattccggcgaatacgaattcaatttcttgaaggaaacagaagct
atcagaaatgatcctacttggcagggacccccattagccccaggtttgattgatcgttcc
actgaaatcactgggccacctttgagaaatatgttggtgaacgccttgaactcggatgtg
aagacgtacatgaccgattttgaagattctgcttccccaacttgggtcaatgtcatttac
ggtcaagtgaacttgtatgacgctattcgtgatcaaattgattttgtcactccaagaaaa
gagtacaagttgcgtggtaagatcgctgatttgccaacgttgattgttagaccaagaggc
tggcacatggttgataaccatatcttggtggatggcgaaccaatcagtgcttctatctta
gatttcggtttgtacttctatcataacgctaagaagttgattgaaattggtaaaggccca
tacttctatttaccaaaaatggaacaccatctagaggccaagttgtggaatgacgttttc
caagtagcccaggattccttggccattcctcgtggtaccattagagctactgtgttgatc
gaaactttaccagctgctttccaaatggaagaaatcatttggcaattgagacaacattct
tctggtttgaactgtggtcgttgggattatatcttctctactatcaagagattaagaaac
aagccagagcatgtattgccaaacagagatcaagtcactatgacctctccatttatgaac
gcatacgtcaagagattgatcaagatttgtcacggacgtggtgttcacgctatgggtggt
atggctgctcaaattccaatcaaggataacgaggaagcaaacaacgctgctatgaccaag
gtccgtaacgataagattagagaattgactaacggtcacgatggttcctgggttgctcac
ccagctcttgctgccatctgtaacgaagttttcgccgaaatgggtactccaaaccaaatc
tattttgtgccagaaacttctgtcgctgcctcagacttgttaaacactaacatcgaaggt
ggtgaaattactactgccggtatcaagcaaaacttagacattggtttgcaatatatggag
gcttggttgagaggaagtggttgtgttccaatcaataacttgatggaagacgctgccacc
gctgaagtgtcccgttgtcagctacaccaatgggtcaagcataagattgtgttaaaggat
actggtaaacaagtcactcctgcacttgctaaggaaattctttaccaacaagctaaagaa
ctagctgccaagtctcctgttggtgatgctaacaagttcgagctagctgctacatacttc
gaacctgaaatcaccggtgaaaaattcagcgaatttttaactacactattgtacgaagag
atcatcactgtaaactctactccatacgacttgtccaaattgaaatga

DBGET integrated database retrieval system