KEGG   Kluyveromyces lactis: KLLA0F25652gHelp
Entry
KLLA0F25652g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kla  Kluyveromyces lactis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KLLA0F25652g
   00052 Galactose metabolism
    KLLA0F25652g
   00500 Starch and sucrose metabolism
    KLLA0F25652g
   00520 Amino sugar and nucleotide sugar metabolism
    KLLA0F25652g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KLLA0F25652g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:2382288..2383790
Genome map
AA seq 500 aa AA seqDB search
MSTVKKHTKTHSTYAFESNTNSVAASQMRNALNKLVDSVNDDTVRSKFENEMDSFFSLFR
RYLAEKSSGNTLDWDKIKSPSADEVVDYKVVESSQAENVSNLDKLAVLKLNGGLGTSMGC
VGPKSVIEVRDGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNTDADTEHLIKKYSANRI
RIRSFNQSKFPRVLRDSLLPVPQSFNDALDSWYPPGHGDLFESLHSSGELDALLAQGREI
LFVSNGDNLGATVDLKILNHMIETGAEYIMELTDKTRADVKGGTLISYDGQVRLLEVAQV
PKEHVDEFKNIRKFKNFNTNNLWINLRAIKRLIESQALSMEIIPNQKTITRNGHEINVLQ
LETACGAAIRHFKGAHGVVVPRSRFLPVKTCSDLLMVKSDLFFLEHGALKIDPTRFGANP
LIKLGSHFKKVSGFNCHIPHIPKIIELDHLTITGNVYLGKNVTLKGTVIIVCSEGQRIDI
PNGSVLENVVITGNLQILEH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagtgaagaagcataccaaaactcattccacatacgcgtttgagagcaacaca
aacagtgttgctgcatctcaaatgagaaatgcattgaacaaattggttgattcggtaaat
gatgatactgtccgtagcaagtttgagaacgaaatggattcgttcttttccctatttagg
agatatttggctgaaaagtctagtggtaatactttggattgggataagatcaaatcccct
agcgcggatgaagttgtggattataaggtcgttgaatcatctcaggccgaaaacgtgtcc
aacttggataaattggcagttttgaagttgaacggtggcttaggtacctcaatgggttgc
gtgggtcctaaatcagtgatcgaagttagggatggtaacacttttcttgatttgtccgtt
cgtcaaattgagtatttgaatagacaatacgactcagatgttccgttgctattgatgaac
tcattcaataccgatgccgacactgaacacttgatcaagaaatactctgcaaacaggatc
agaattagatcttttaaccagtcaaagttccctcgtgttctgagggattctttactacct
gtgccacaatctttcaacgatgcattagactcctggtacccacctggccatggtgatttg
tttgagtccttgcattcttccggggaattggatgctctattggctcaaggaagggagatc
ttgtttgtttcaaacggtgataacttgggtgctactgttgatctcaagattttaaaccac
atgattgaaactggggctgaatacataatggaattaaccgacaagacaagagcagatgtc
aagggtggtactttgatctcatacgatggccaagtgcgtttgctagaagttgcccaggtt
cctaaggaacatgttgacgaattcaagaacatcagaaaattcaagaacttcaacaccaac
aatttatggatcaacctaagagctatcaagagattgattgaatcacaagcattatctatg
gaaatcatccctaatcaaaagacaattactagaaatggtcacgaaataaatgtcttacaa
ctagaaaccgcatgcggtgctgccatcaggcatttcaagggtgcccatggtgttgttgtc
ccaagatcaaggttccttcctgtaaagacttgttctgatttattaatggtcaaatctgac
ttgttcttcctagaacacggtgccttaaagatcgatccaacaaggttcggtgcaaatcca
ttaatcaaactaggttctcatttcaaaaaagtgtccgggtttaactgccatattcctcat
attccaaagattatcgaactagatcatctaaccattactggtaatgtttatttgggtaaa
aacgtcactcttaagggaactgtgatcattgtttgctctgaaggtcaaagaattgatatc
cctaatggatctgttttggagaacgttgttattactggtaacttacaaatattagagcac
tga

DBGET integrated database retrieval system