KEGG   Kluyveromyces lactis: KLLA0F27995gHelp
Entry
KLLA0F27995g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
kla  Kluyveromyces lactis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KLLA0F27995g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     KLLA0F27995g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:2586722..2587954
Genome map
AA seq 410 aa AA seqDB search
MKVAGFILGALIQFSLTEGHVEQNENANLTEMWGEDWPFSGIQTFAHLPHHKCLIDMEKK
FDIGVIGVPFDTAVSFRGGARFGPQAIRKASQRQTSMRGFNFRADINPYQDWASVVDCGD
VPVTPMDNCLALKMMTAAYENLLSHESQTSDNNLPPRFVTLGGDHSIILPALRALRKTYG
RLAVIHFDSHLDTWAPSKYPSFWHSDTSEFTHGSMLWIAHNEGLLTENNNIHAGLRTRLS
GSSFEDYDDDDKVGFHRIEADEIMDGGIKSIVEKIKSKIPSDVPVYISVDIDVLDPSAAP
GTGTMEVGGWMTRELIRIIRELEDLNLVGADIVEVSPPFDPTEITSLAGAQIAYELITNM
VKKGPIDPELIKHNLELSDKLTQGQQLLGFSSPTDELNDKIQKEQFVLQA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgcaggatttatattgggtgctttgatacaattcagccttactgaaggacat
gtagaacagaatgaaaatgccaatctaacagaaatgtggggcgaggactggcccttttct
ggaattcaaacctttgcacacttacctcaccacaagtgtttgatcgatatggaaaagaag
tttgatataggggtcataggagttccgttcgatacagctgtgagctttagagggggtgct
agattcgggccacaggccattcgtaaggcatcccaacgccaaacttcgatgcgcgggttc
aatttccgtgcagacatcaatccatatcaagattgggcttctgtggtcgattgcggtgac
gttccagtaacaccgatggataattgcttagcgttgaaaatgatgactgcggcatatgag
aatcttttgagccatgaatcccagacaagcgacaataatttacctccaaggtttgtcact
ctgggcggtgaccatagtatcatcttgccagcgctacgtgctctaagaaaaacttacggt
cgtcttgctgtcatccatttcgactctcacttagatacctgggcaccttctaagtaccca
tccttctggcacagtgatacttcggagtttactcacggttcaatgttatggatagctcat
aacgaaggtttactcactgaaaataacaatatccatgctgggttgagaaccagattaagc
ggatctagtttcgaagattacgatgatgatgacaaagtcggatttcaccgtatcgaagca
gacgaaattatggacggcggtattaagtccattgttgaaaagatcaaatcaaaaattcct
agtgatgtcccggtctatataagtgtcgatatcgacgttttagatccatctgcagcacca
ggtacaggaactatggaagtcggaggatggatgactagagaattgatccgtattattcgt
gaactagaagatctcaacctcgtcggtgcagatattgttgaagtatctccaccattcgat
cctactgaaattacatcgttagctggtgctcaaattgcatacgaattgatcacaaacatg
gtgaagaaaggaccaatagatccagagctgattaagcataatcttgaattatcagataag
ttgactcaaggacaacaattgttaggtttttcaagcccaacggatgaactaaatgacaaa
atccaaaaagaacaatttgttttgcaagcctga

DBGET integrated database retrieval system