KEGG   Klebsiella michiganensis RC10: VW41_11285Help
Entry
VW41_11285        CDS       T03782                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
kmi  Klebsiella michiganensis RC10
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VW41_11285
   00500 Starch and sucrose metabolism
    VW41_11285
Enzymes [BR:kmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     VW41_11285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2392189..2393598)
Genome map
AA seq 469 aa AA seqDB search
MTLASRLPAILQAVMKGQPNALRDKHYPQWHHAPVTGLMNDPNGFIWFAGRWHLFYQWNP
LAADHKYKCWGHWSSADLVQWRHEPLALMPDREYDRNGCYSGSAVGVEGRLTLCYTGNVK
FEDGSRTAWQCLAVENSAGGFDKAGPILPLPEGYSGHVRDPKVWQHEGVWYMVLGAQDLH
KQGKVLLFSSPNLHDWENRGEIAGSGVHGLTDAGYMWECPDLFPLDGKHVLLCCPQGLAR
QDERFLNVYPAAYLVGDFDYASVAFSHGELTELDAGFEFYAPQTAQSPDGRRLLVGWMGV
PDGEEMLQPTREQGWIHQMTCLRELTLKNGKLYQNPIAELASLREEERRWQGQAGQAPAL
NGKRLELQINTTGDFSIDFGGGLTLDVTDRGIVLERPSLASGEPLFRYWHGTVASLQILC
DSSSVEIFINRGEGVMSSRYFPHPSERLSFSGESAVTLRYWSLRSCMIE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttgcctcacgtttaccggccattctgcaggccgttatgaaaggccagcccaac
gccctgcgggataagcattatccgcagtggcaccatgccccggtgaccgggttaatgaac
gatccgaacggatttatctggtttgccgggcgctggcacctgttttatcagtggaacccg
ctggcggcggaccataaatacaagtgctggggacactggagttcggctgatttagtccag
tggcgccacgagccgctggcgctgatgccggatcgagagtatgaccggaacggctgctac
tccgggagcgccgtgggcgtcgaaggcaggctgacgctgtgctataccggcaacgtcaag
ttcgaagacggcagccgcaccgcctggcaatgcctggcggtggaaaacagcgccggtggc
tttgacaaagctggcccgattttgccgctgcccgagggctacagcgggcatgtgcgagac
ccgaaggtctggcaacacgagggggtctggtacatggtcctgggcgcacaggacctgcac
aaacaaggcaaggtgctgctgttttcatcccccaatctgcatgactgggaaaacagaggc
gaaatcgccggcagcggcgttcacgggctgactgacgcaggttatatgtgggaatgcccc
gatctcttcccccttgacggcaaacatgtactgctgtgttgtccgcaggggcttgcccgg
caagatgagcgttttcttaacgtttaccctgcggcgtatctggtcggcgattttgattac
gcttcggttgcattcagccacggtgaactgaccgagctggacgcagggtttgaattctac
gccccgcaaacggcgcagtcgccggacggacggcgtttgctcgtcggctggatgggggtg
ccggacggggaggagatgctgcagccaacccgcgagcaaggctggatccatcagatgacc
tgcctgcgggagctcacgcttaaaaacggcaagctttatcaaaacccgatagcagaactg
gcttcgctgcgcgaagaggagcggcgctggcagggccaggccggtcaggctccggcgctg
aacggcaaacggcttgaactacagataaacaccacgggggacttcagtatcgactttggc
ggtggcctgacgctggacgtgactgaccggggcattgtgctggagcggccgagtctggca
tccggtgaaccactttttcgctactggcacggtacggttgcctcgctgcagatcctgtgc
gacagctcaagcgttgagatctttatcaatcggggggaaggggtgatgagcagccgctat
tttccacacccttcggagcggctctctttcagcggtgagtcggcggtcacgttgcgctac
tggtcgctacgctcctgcatgatagaataa

DBGET integrated database retrieval system