KEGG   Klebsiella oxytoca CAV1374: AB185_06650Help
Entry
AB185_06650       CDS       T04534                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
koc  Klebsiella oxytoca CAV1374
Pathway
koc00052  Galactose metabolism
koc00500  Starch and sucrose metabolism
koc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:koc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AB185_06650
   00500 Starch and sucrose metabolism
    AB185_06650
Enzymes [BR:koc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AB185_06650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 EMP24_GP25L Amb_V_allergen
Motif
Other DBs
NCBI-ProteinID: AKL33596
UniProt: A0A0G3S091
Position
complement(290624..292312)
Genome map
AA seq 562 aa AA seqDB search
MSLSFNIKQGQRIDLWLKASEPAAQPLFSIRVNGQVVFKIQEAPRYFQYFTWTSFQDGVA
TLEWLPEYSEISLCYTWHPDSLRARGVTFIATAGQDLRLMSGQDIADEYMREPLRPALHF
SPRTGWMNDPNGLHYKNGEWHLFYQYHPHSNQWGPMHWNHAVSRDLYHWRHYPVFLQPEQ
NLSALGATGGAFSGSAYIDKQGKTRFWYTERLPAYDLYRGYREVQKMAVAHDDYDKPEWV
KTVLTDLPAGVDCDFRDPKVWYEEADATFYMILGASVNGDPAMLLFHSADSERWTFHHVL
YVAPSYFRENGGRCVECPDFFCLDGVWVLIIGVVGYTEPTTGRHNLLFAQTGTFRNGYFT
PSEQPLQTLDFGTDFYALQTWGEDDRRIGFAWLYNWATQKPVDSAYSGEMSLPRRFHLNA
QQRLCMMPELPPESLVVSRHALDDGDIWVNEKGCKAGIVTFMPAGGFRLTLTGDSGQQII
LEQEGKNLTLYEKGRDDGRYRAPVAGVSDVTLCFDAGIVEVFANQGSVCGTRRYYSCSQL
TRIQLSGAPAQLTQYRSTYSQE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgtcatttaatattaaacaaggtcagcgcattgatttgtggctgaaagcgtcc
gaaccggcggcgcaacccctgttttctattcgcgtgaacggtcaggttgtatttaagatt
caggaggcgccgcgctacttccagtattttacctggacctcgtttcaggacggcgttgcc
accctggagtggctgccggaatatagcgagatatcgctttgttacacctggcatccggat
tcactgcgcgcgcgcggcgttacctttatcgcgacagccgggcaggatttgcgcctgatg
agcggtcaggatattgctgacgagtatatgcgggagccgctgcgtccggcattgcatttc
tcgccccgtaccggctggatgaacgaccctaacgggctgcactacaagaacggcgagtgg
catctgttttaccagtatcatccgcactccaaccaatggggccccatgcactggaatcat
gcggtgagccgcgatctgtatcactggcggcattatccggttttcctccagccagagcag
aatctttcggcgctgggcgcgacgggcggcgcgttttccggcagcgcgtatattgataaa
caaggaaaaacccgcttctggtataccgaacggctcccggcttacgatctgtatcgcggc
taccgggaagtgcagaaaatggccgttgcgcacgacgactacgataagccggaatgggtg
aaaaccgtcttaaccgacctgcctgcgggcgtggactgcgatttccgcgatccaaaagtg
tggtacgaagaggccgatgccactttttatatgatcctcggcgcgtcggtaaacggcgat
ccggcgatgctgctctttcactctgcggatagtgaacgctggacgttccatcatgtgctg
tatgtcgctcccagctattttcgcgaaaacggcggtcgctgcgtcgaatgcccggatttc
ttctgcctggatggcgtatgggtattaattatcggcgtcgttggctatacggagccgaca
accgggcggcataatttgctttttgcccagaccggtactttccggaacggctatttcacg
ccgtccgagcagccgctacagactttagatttcggtacggatttctacgccctgcaaacc
tggggcgaggacgaccgaagaatcggctttgcctggttatataactgggcgacccagaaa
ccggtggattccgcttactcgggggaaatgtcgctcccgcgtcgctttcatctcaatgcg
cagcagcggctatgcatgatgccggagctgccgccggaatcattggtcgtcagccgccat
gcgctggatgacggtgatatctgggttaatgagaaaggctgtaaagccggcattgtaacc
tttatgcctgccggtggtttccgtttgacgttaacgggcgatagcggccagcaaatcatc
ctcgaacaggagggtaaaaatctgacgctatatgaaaaaggccgggacgatgggcgttac
cgcgcgccggtggccggcgtcagcgacgtcaccctgtgttttgatgccgggattgttgag
gtcttcgcaaatcagggcagcgtatgcggtacgcgacgctattactcatgcagtcagctc
acccggatccagctctccggcgcgccggcacagcttacgcaatatcgctcgacgtattcg
caggaataa

DBGET integrated database retrieval system