KEGG   Klebsiella michiganensis E718: A225_0067Help
Entry
A225_0067         CDS       T02173                                 

Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00052  Galactose metabolism
koe00500  Starch and sucrose metabolism
koe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:koe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A225_0067
   00500 Starch and sucrose metabolism
    A225_0067
Enzymes [BR:koe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     A225_0067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C EMP24_GP25L Amb_V_allergen
Motif
Other DBs
NCBI-ProteinID: AFN30030
Position
69387..71075
Genome map
AA seq 562 aa AA seqDB search
MSLSFNIKQGQRIDLWLKASEPAAQPLFSIRVNGQVVFKIQEAPRYFQYFTWTSFQDGVA
TLEWLPEYSEISLCYTWHPDSLRARGVTFIATAGQDLRLMSGQDIADEYLREPLRPALHF
SPRTGWMNDPNGLHYKNGEWHLFYQYHPHSSQWGPMHWNHAVSRDLYHWRHYPVFLQPEQ
NLSALGATGGAFSGSAYIDKQGKTRFWYTERLPAYDLYRGYREVQKMAVAHDDYDKPEWV
KTVLTDLPAGVDCDFRDPKVWYEEADATFYMILGASVNGDPAMLLFHSADSERWTFHHVL
YVAPGYFRENGGRCVECPDFFCLDGVWVLIIGVVGYKEPTTGRHNLLFAQTGTFRNGYFT
PSEQPLQTLDFGTDFYALQTWGEDDRRIGFAWLYNWATQKPVDSAYSGEMSLPRRFHLNA
QQRLCMMPELPPESLVVSRHALDDGDIWVNEKGCKAGIVTFMPAGGFRLTLTGDSGQQII
LEQEGKNLTLYEKGRDDGRYRAPVPSVSDVTLCFDAGIVEVFANQGSVCGTRRYYSCSQL
TRIQLSGAPAQLTQYRSTYSQE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgtcatttaatattaaacaaggtcagcgcattgatttgtggctgaaagcgtcc
gaaccggcggcgcaacccctgttttctattcgcgtgaacggtcaggttgtatttaagatt
caggaggcgccgcgctacttccagtattttacctggacctcgtttcaggacggcgttgcc
accctggagtggctgccggaatatagcgagatatcgctttgttacacctggcatccggat
tcactgcgcgcgcgcggcgtcacctttatcgcgacagccgggcaggatttgcgcctgatg
agcggtcaggatattgctgacgagtatctgcgggagccgctgcgcccggcattgcatttc
tcgccgcgtaccggctggatgaacgatcctaacgggctgcactataagaacggcgagtgg
catctgttttaccagtatcatccgcactccagccaatggggccccatgcactggaatcat
gcggtgagccgcgatctgtatcactggcggcattatccggttttcctccagccggagcag
aatctttccgcgctgggcgcgacgggcggcgcgttttccggcagcgcgtatattgataaa
caaggaaaaacccgcttctggtataccgaacggctcccggcttacgatctgtatcgcggc
taccgggaagtgcagaaaatggccgttgcgcacgacgactacgataagccggaatgggtg
aaaaccgtcttaaccgacctgcctgcgggcgtggactgcgatttccgcgatccaaaagtg
tggtacgaagaggccgatgccaccttttatatgatcctcggcgcctcggtaaacggcgat
ccggcgatgctgctatttcactctgcggatagtgaacgctggacgttccatcatgtgctg
tatgtcgctcccggctattttcgcgaaaacggcggtcgctgcgtcgaatgcccggatttc
ttctgcctggatggcgtatgggtattaattatcggcgtcgttggctacaaggagccgaca
accgggcggcataatttgctttttgcccagaccggtactttccggaacggctatttcacg
ccgtccgagcagccgctacagactttagatttcggtacggatttctacgccctgcaaacc
tggggcgaggacgaccgaagaatcggctttgcctggttatataactgggcgacccagaaa
ccggtggattccgcttactcgggggaaatgtcgctcccgcgtcgctttcatctcaatgcg
cagcagcggctatgcatgatgccggagctgccgccggaatcattggtcgtcagccgccat
gcgctggatgacggtgatatctgggttaatgagaaaggctgtaaagccggcattgtaacc
tttatgcctgccggtggtttccgtttgacgttaacgggcgatagcggccagcaaatcatc
ctcgaacaggagggtaaaaatctgacgctatatgaaaaaggccgggacgatgggcgttac
cgcgcgccggtgcccagcgtcagcgacgtcacgctgtgttttgatgccgggattgttgag
gtcttcgcaaatcagggcagcgtatgcggtacgcgacgctattactcatgcagtcagctc
acccggatccagctctccggcgcgccggcacagcttacgcaatatcgctcgacgtattcg
caggaataa

DBGET integrated database retrieval system