KEGG   Klebsiella michiganensis E718: A225_0767Help
Entry
A225_0767         CDS       T02173                                 

Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00240  Pyrimidine metabolism
koe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:koe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    A225_0767
Enzymes [BR:koe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     A225_0767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AFN30602
Position
803232..804554
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDSRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSAALAEAIVGVSNGAGVRTTALLT
DMNQVLASSAGNAVEVREALQFLTGEYRNPRLLEVTMALCVEMLISGKLAQNDADARAKL
QAVLDNGKAAEVFGRMVAAQKGPNDFVENYDKYLPAAMLSKAVYAEGEGFVAEMDTRALG
MAVVSMGGGRRQASDLIDYSVGFTDVVRLGARIDAQQPLAVIHAKDENSWQEAAKAVKAA
IKLDDKAPEMTPTVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcgctgagcgatgaa
gagattcgttttttcatcaacggcatccgcgacaacaccatctcagaagggcagatcgcc
gcgctggcgatgaccatttttttccacgatatgtctatgccggaacgcgtttcgctgacc
atggcgatgcgggattcagggaccgttctcgactggaagagtcttaatctcaatggcccg
atcgtcgataaacactctaccggcggcgtaggcgatgtgacctcgctgatgctggggccg
atggtcgcggcctgcggcggctatgtcccgatgatctcggggcgcggtctcgggcacacc
ggcggtacgctcgacaagctggaagcgattcctgggttcgatattttcccggacgatagc
cgcttccgtgaaatcattaaagatgtcggcgtcgcgattatcgggcagaccagctctctg
gcgccggcggacaaacgtttttacgccacgcgcgatatcaccgcaacggtggactctatc
ccgctgatcaccgcctccattctcgccaagaagctggcggaaggcctggacgcgctggtg
atggatgtcaaagtcggcagcggcgcctttatgcctacttatgagctttccgccgcgctg
gccgaagcgatcgtcggggtatccaacggcgccggcgtgcggacgaccgcgctgttaacc
gatatgaaccaggtgctggcttccagcgccggtaatgcggtggaagtgcgtgaagccttg
cagttcctcaccggcgagtaccgcaatccgcggctgcttgaggtgacgatggcgctgtgc
gtcgagatgctgatttccggcaagctggcgcagaatgacgccgacgcgcgggcgaagcta
caggcggtgctggataacggtaaagccgcagaagtcttcggccggatggtggcggcgcaa
aaagggccgaacgacttcgtggaaaactacgataagtatctgccggccgcgatgctgagc
aaagccgtctatgccgaaggcgaagggtttgtcgccgaaatggacacccgcgcgctgggc
atggcggtggtatcaatgggcggcggtcgccgtcaggcatcggatctgattgattacagc
gtcggtttcaccgacgtggttcgcctcggcgcgcgtatcgacgcgcagcagccgctggcg
gttatccatgctaaagatgaaaacagctggcaggaagcggccaaagccgtgaaagcggcc
attaaacttgacgataaagcgcctgaaatgacgccgacggtctatcgtcgtatcaccgaa
tag

DBGET integrated database retrieval system