KEGG   Klebsiella michiganensis E718: A225_1752Help
Entry
A225_1752         CDS       T02173                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00220  Arginine biosynthesis
koe00250  Alanine, aspartate and glutamate metabolism
koe00471  D-Glutamine and D-glutamate metabolism
koe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:koe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A225_1752
   00220 Arginine biosynthesis
    A225_1752
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    A225_1752
Enzymes [BR:koe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     A225_1752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AFN31453
Position
complement(1849548..1850549)
Genome map
AA seq 333 aa AA seqDB search
MNVKFLGTCILTASLLFSAAAQAQSAPDYASIIEQAHQKYKSNHDGKVADYIPALASYSP
NNFAITLATVEGKIYQTGDVTKAFPMESLSKVFTLALAMEQRGPQEVLDKLGANATGLPF
NSGLAVELTQGAPENPLVNAGAMSTVSLIAAKDKTDRWNNILNNLNAWADSSLSVNEPVF
QSEMETNQHNQALAMLMNSYRSFYGDPQEAVEIYTRQCSVDITVEQLAKMGAVLANNGKS
PFNGKQLLTASYVPQVLAEMAIAGLYDGSGKWLYTVGIPAKSGVGGGMVAVVPGQYAIAV
YSPPLDAAGNSVRAQQTIEYVANATRANLFLAK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgaaatttcttggcacctgcatcttaaccgccagcttactgtttagcgccgcc
gcgcaggcgcaaagcgcgccggactacgccagcatcatcgagcaggcacatcagaaatat
aagagtaatcacgacggtaaagtcgccgactatatccctgccctggcgagctatagcccg
aataatttcgccattacgctcgcgacggtcgaaggcaaaatttaccagaccggcgacgtg
acaaaagcctttccgatggaatcattaagtaaagttttcaccctggcgctggcgatggag
cagcgcgggccgcaggaggtgctggataaactcggcgcgaacgcgaccggcctgcccttc
aattccggcttagccgtggagctcacgcaaggcgcgccggagaacccgttagtcaacgcc
ggcgccatgagcaccgtgagcctgattgcggcgaaagacaaaaccgaccgctggaacaac
attctcaacaacctcaacgcctgggccgacagctccctgagcgttaacgagccggtattt
caatccgaaatggagaccaatcagcataaccaggcgctggcgatgctgatgaattcatac
cgcagcttctatggcgaccctcaggaagccgtcgaaatctacacccgtcagtgttcggtg
gatatcaccgttgagcagctcgccaaaatgggggccgtactcgccaacaatggcaaatca
ccgttcaacggcaagcagctgctcaccgccagctacgtcccgcaggtgctggcggaaatg
gcgatcgccgggctgtacgacggcagcggcaaatggctgtacaccgtcggtatcccggca
aaatccggcgttggcggcggaatggtcgccgtcgttcccgggcaatacgctatcgccgtc
tactcccctccgctggatgcagccggcaacagcgtccgcgcccagcagaccatcgagtac
gtcgcgaatgcgacgcgggccaatctctttttagcgaaatag

DBGET integrated database retrieval system