KEGG   Klebsiella oxytoca E718: A225_2501Help
Entry
A225_2501         CDS       T02173                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
koe  Klebsiella oxytoca E718
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:koe00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A225_2501
  Amino acid metabolism
   00380 Tryptophan metabolism
    A225_2501
Enzymes [BR:koe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     A225_2501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2641994..2644252)
Genome map
AA seq 752 aa AA seqDB search
MSDKHHNPQPHQSPVHDDREAKPGLDALAPEDQNWRPTPHPTAPGEEPTAPGSMKAPDTR
SEKLDALEKQRKGGEDFALTTNQGVRIADDQNSLRAGKRGPTLLEDFILREKITHFDHER
IPERIVHARGSAAHGYFQAYSDLSDITKAAFLCDPQKKTPVFVRFSTVQGGAGSADTVRD
IRGFATKFYTDEGIFDLVGNNTPIFFIQDAIKFPDFVHAVKPEPHWAVPQGQSAHDTFWD
YVSLQPETLHNVMWAMSDRGLPRSYRTMEGFGIHTFRLINAEGKATFVRFHWKPVAGKAS
LVWDESQKLTGRDPDFHRRDLWEAIEAGDYPEYELGLQLIPEEDEFAFDFDLLDPTKLIP
EALVPVQRVGKMVLNRNPDNFFAENEQAAFHPGHIVPGIDFSNDPLLQGRLFSYTDTQIS
RLGGPNFHEIPINKPTCPYHNFQRDGMHRMDIDTNPANYEPNSINDNWPRETPPAAKRGG
FESYAERVDGEKIRQRSPSFGEYYSQPLLFWRSQTPIEQQHIIDGFSFELSKVVREWIRE
RVVDQLAHIDLQLAQAVGKNLGIELTDEQRSITPPPDVNGLKKDPTLSLYAIPSGDVKGR
VVAVLLNDRPVAKELLTLLKALKAHGVHAKLLYSRMGKVQADDGTELPVAGTFAGSPSLT
VDAVIVPGGDLQSLSNNGDFHYYLLEAYKHLKPILLAGDARQCKAPLQVASQGEEGIVET
DAIDNASVDALITLMAAHRVWSRSAKISAIPA
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataaacaccataacccgcaaccccatcaatcaccggttcacgacgaccgggaa
gcaaaaccaggtctggatgccttagcccccgaagatcagaactggcggcccacgccgcat
cccaccgccccaggtgaagagccgaccgccccgggcagtatgaaagccccggatacgcgc
agcgaaaagctcgatgcccttgaaaaacagcgtaaaggcggcgaggattttgcgctcacc
accaatcagggcgtacgcatcgcagacgaccagaactcgctgcgcgcgggcaaacgcggc
cccacgctgctggaagattttatcctgcgcgaaaaaatcacccattttgaccacgagcgc
attcctgagaggatcgtccatgcccgcggctccgctgcgcacggctatttccaggcgtac
agcgatttaagcgatatcaccaaagcggctttcctctgcgatccgcagaaaaaaacgccg
gtcttcgtccggttttccaccgttcagggcggcgcaggctccgccgatacggtgcgcgac
atccgcggctttgccaccaagttttataccgacgagggcatctttgacctggtcggcaac
aacacgccgatcttttttattcaggacgcgatcaagttccctgatttcgtccacgcggtc
aaacccgagccgcactgggccgtcccgcaggggcaaagcgcgcacgacacgttctgggat
tacgtctcactgcagcccgaaacgctgcataacgtgatgtgggcgatgtccgaccgcgga
ctgccccgcagctaccgcacgatggaagggttcggcatccacaccttccgcctgattaac
gcggaaggtaaagccaccttcgtacgttttcactggaagccggtcgcgggcaaagcctcc
ctggtatgggacgagtcgcaaaagctgaccggtcgcgatcccgatttccaccgccgtgat
ttatgggaagcgattgaagccggcgattatcctgagtacgagctgggcttacagctgatc
ccggaagaggacgagtttgcttttgatttcgatctgctggatcccaccaagctgattccg
gaagcgctggtcccggtgcagcgcgtcggtaagatggtcctcaatcgcaacccggacaac
ttctttgccgaaaacgaacaggcggccttccatccagggcatatcgttccggggatagac
ttcagcaacgatccgctgctgcagggccgactcttctcctataccgatacgcagatcagc
cgcctcggcgggccgaatttccatgaaattccgatcaataaacccacctgcccgtaccat
aatttccagcgtgacggcatgcaccggatggatattgataccaacccggcaaactatgaa
cctaactccatcaacgataactggccgcgggagacgccgccggccgctaaacgcggcggc
tttgaatcctatgccgagcgggttgacggggaaaagattcgccagcgcagtccgtcgttt
ggcgaatattactcgcagcccctgctgttctggcgtagccagacgcctattgagcagcag
catattatcgacggattcagcttcgagctgagcaaggtcgtcagggagtggatccgcgag
cgggtggtcgatcagctggcgcatatcgacctgcagctggctcaggcggtgggtaaaaat
ctgggtattgagctcaccgacgaacagcgcagcatcacgccgccgccggatgttaacggt
ctgaaaaaggatcctacgttaagcctgtacgctattcccagcggtgacgtaaaaggccgg
gtggtagcggtactgcttaacgatcgtccggtcgccaaagagctcctgacgctgctcaag
gcgctcaaagcgcacggggtgcatgccaaactactctattcccgaatggggaaagtgcag
gccgatgacggtaccgagctgccggtggccgggacctttgccgggtcgccatcgcttacc
gtggacgcggtcattgttcccggcggcgatctgcaaagcctgagcaacaacggtgatttc
cactactacctgctggaagcctataaacacctgaagccgattctgctggcaggcgatgcc
cggcagtgcaaagcgccgctgcaggttgccagtcagggggaagaaggcatcgttgagacg
gacgccatcgataatgcgtcggtggatgcgctgattacactgatggcggcgcatcgggtg
tggtcgagaagcgccaaaatctccgcgatcccggcgtaa

DBGET integrated database retrieval system