KEGG   Klebsiella oxytoca E718: A225_2825Help
Entry
A225_2825         CDS       T02173                                 

Definition
pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
koe  Klebsiella oxytoca E718
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:koe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A225_2825
   00500 Starch and sucrose metabolism
    A225_2825
Enzymes [BR:koe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     A225_2825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2982260..2983516
Genome map
AA seq 418 aa AA seqDB search
MRKITILGISALLFTPLVLQGCATQTPRGTTSRPQLTAAEAATFTIERYFAQGGALNDPD
GPWSPSPVHLPQTESAWRVAPSGAPFTRIQQAVNAAIGQHGAQEARIYIRIEPGIYRETV
YIPEGAPPTTLYGAGDSPEEVRIELAIDSQFSVARYRQRVNSQQQYREGDPAWYQYALCA
GRTSKTIGTNCAAVVWSQSADFQLLNLSVANSLLDTVDGGTHQGVALRTDGDRVQLENVR
LLGRQDTLYVNTSNRRNEAVTDRISRVYVKDSYVEGDVDYVFGRANAVFDNVHFHTVSTR
RSPEAYVLAPNTLPDNPYGFLVKNSRFTGDGGYQGSFKAKLGRAWDQGAGKTGYLAGKTA
NGQVLIANSIIDQSYDRLSPWDAAATTARPFRGNTSAERQLDDVAFTRLWEFNNHWQP
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaatcactatcctgggtatctcggctttactctttacaccgctggttctgcaa
gggtgcgcgacgcaaactccgcgcgggacgacctcccgtccgcagcttacggcggcagaa
gcggcaaccttcaccattgagcgctattttgcgcaaggcggtgcgttaaatgaccccgat
ggcccctggtcgccatcgccagttcacctcccgcaaaccgagagcgcgtggcgcgtggca
ccctcgggagcgccgttcacccgcattcagcaggcggttaacgcggcaataggccagcat
ggggcgcaggaggcgcgcatctatatccgcatcgaaccgggcatctatcgggagacggtc
tatatccctgaaggcgcgccgccgacaaccctctacggcgccggagatagtcctgaagag
gtgagaattgagctggcaatagactcgcagttctcggtagcgcgctatcgccagcgggta
aatagccaacagcaataccgcgaaggcgatccggcatggtatcagtatgcgctgtgcgcc
gggcgaaccagcaagacgataggcaccaactgcgcggcggtggtctggtcgcaaagtgcg
gattttcagctgctgaatctcagcgtagccaatagcctgctggataccgtcgacggtggg
acgcatcagggcgtggcgctgcggacggacggcgatcgcgtgcagctggagaacgtccgc
ctgctcggacgtcaggacacgctctacgtaaataccagcaatcggcgcaatgaggcggta
accgaccgtatcagccgggtatacgtgaaagacagctacgtcgaaggggatgtggactac
gtctttggccgggcgaacgccgtttttgataacgtccattttcacaccgtctcaacgcgc
cgctcgcctgaggcatacgtgcttgcgccgaatacgttgccggataatccatacggcttt
ctggtgaagaatagccgctttaccggcgacggcggctatcagggcagcttcaaggcgaag
ctgggccgcgcctgggatcagggggcggggaagaccggttatttagcgggtaaaaccgct
aacgggcaggtgcttattgccaacagtattatcgatcaaagctacgatcggctttccccc
tgggacgctgcggccaccaccgcccggccgttccgcggcaacacttccgcagaacggcag
cttgatgatgttgccttcactcgcctgtgggaattcaataaccactggcagccctga

DBGET integrated database retrieval system