KEGG   Klebsiella oxytoca E718: A225_3317Help
Entry
A225_3317         CDS       T02173                                 

Definition
Trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
koe  Klebsiella oxytoca E718
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:koe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A225_3317
Enzymes [BR:koe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     A225_3317
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     A225_3317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3488617..3490242
Genome map
AA seq 541 aa AA seqDB search
MADWHTRAIIYQIDSALFYDLNGDGCGDIAGIAAKLRYIRRLGATVIWITPFYLTPFLDE
GYDVSDHLQVDPRFGQLADIIAFIEQARELGMQVIIELLIQHTSDAHPWFQQARRSRRSP
FRDYYLWADSDDDNTPPMFPGVEESIWSWDDEAGQYFRHMFYRHEPDLNLASPAVIKEVE
NIVIFWLKLGVSGFRLDAASHLTKQAGRGEEKRGLWLLEHLRRLVEQHNPQAILLGEVDV
EVAQYRDYFGDNNRLNMVLNFWLNKYFYVSLASQSARPLIEAIKKMVVPPDACCFANWLR
NHDELDLEGIGNKNKQTVLDAFAPDKEMNVYQRGIRRRLAPMLNSDRRRLAFCHAVLFSL
PGVPIMRYGDEIGMGDDLALEERYAVRTPMQWAGSAGGGFSAADPQTFVAPMIDRGPFRY
QKVNVADSLLHRHSLLHRIIDIANTRSEFPEIAVAPFRIISTDRQAILGICYDDRERSVI
AFLNFSDKPLRFTAKGIYAAVWTPCLADKTYADALTPGKHAKLEISAYGYRWFWTNSSAL
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggctgactggcatacgcgggccattatctatcagattgattcagcactgttttacgat
cttaacggcgatggctgcggcgatatcgccgggatcgcggcgaagctgcgctatattcgc
cgactgggcgcgacggtgatctggataacgcccttctacctgacgccgtttctggatgag
ggttacgatgtcagcgaccatctgcaggtcgatccgcgatttggtcaactggcggatatc
attgcttttatcgagcaggcccgcgaattaggcatgcaggttattattgaattgctgatc
cagcacacctccgacgctcacccctggtttcaacaagcgcggcgcagccgtcgctcgccg
ttccgcgactattatctgtgggcagatagcgatgatgacaatacgccgcccatgtttccc
ggcgtcgaagagagcatctggtcgtgggatgacgaagccgggcaatattttcgccatatg
ttttaccgccatgaacccgatctcaatctggcctctcccgcggtgatcaaagaggtcgaa
aatatcgttatcttttggctgaagctgggggtttccggctttcgtctggatgccgcctcg
catttgacgaaacaggccggacgcggcgaggagaaacgcgggctatggctcctggaacat
ctgcgtcggctggttgaacaacataatccgcaggccatactgctcggcgaagtcgacgtt
gaggtggcgcagtatcgcgactattttggcgataataaccgacttaatatggtacttaac
ttctggctgaacaaatatttttacgtcagcctcgccagccagagcgcccgcccgctgatc
gaggccatcaagaaaatggtagtgcctcctgacgcctgctgcttcgcaaactggctgcgc
aaccacgatgaactggatcttgaagggatcggtaacaagaacaagcagaccgtgctggat
gccttcgcgccggataaggagatgaacgtttatcagcgcggtattcgccgtcggctggcg
cccatgctgaacagcgaccggcggcggctggcgttctgtcatgccgtgcttttttcgctg
cccggcgtaccgatcatgcgctacggggatgagatcggcatgggtgacgacctggcgctg
gaagagcgctacgcggtgcgtacgccgatgcagtgggccggttcagcgggcggcggcttc
tccgcagccgatccgcagacgtttgtggctcccatgatcgaccgggggccgtttcgctat
cagaaagtcaacgtcgctgattccctgctgcaccgccattctctcctgcaccgtattatt
gatatcgccaatacgcggtcagaattcccggaaatcgccgttgcgcctttccgcatcatt
agcaccgatcggcaggcgattctcgggatctgctacgatgaccgcgagcgcagcgtcatc
gcctttcttaatttcagtgataaaccgctgcgttttaccgcgaaagggatctatgcggcg
gtgtggacgccctgcctggccgacaaaacctacgcggacgcgctcactcccggtaagcac
gctaagctggagattagcgcatatggctatcgatggttctggaccaacagtagcgcgctg
cgttag

DBGET integrated database retrieval system