KEGG   Klebsiella michiganensis E718: A225_3412Help
Entry
A225_3412         CDS       T02173                                 

Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00360  Phenylalanine metabolism
koe00362  Benzoate degradation
koe00620  Pyruvate metabolism
koe00621  Dioxin degradation
koe00622  Xylene degradation
koe00650  Butanoate metabolism
koe01100  Metabolic pathways
koe01120  Microbial metabolism in diverse environments
koe01220  Degradation of aromatic compounds
Module
koe_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:koe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A225_3412
   00650 Butanoate metabolism
    A225_3412
  Amino acid metabolism
   00360 Phenylalanine metabolism
    A225_3412
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A225_3412
   00622 Xylene degradation
    A225_3412
   00621 Dioxin degradation
    A225_3412
Enzymes [BR:koe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     A225_3412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA NAD_binding_3 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AFN29645
Position
complement(3595183..3596133)
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPESDGLARARRMGVATTHEGVG
GLMQMAEFADIDVVFDATSAGAHVKNDAALREARPGIRVIDLTPAAIGPYCVPVVNLEAN
LAEGNVNMVTCGGQATIPMVAAVSRVAKVHYAEIIASIASKSAGPGTRANIDEFTETTSQ
AIEKVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSEAASQQAIAASIAEMAAAVQAYVPGY
RLKQQVQFEVIPEDKPVNLPGVGRFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAALAT
AEKMAQAMNDAAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacgtaaagtcgccattatcggctccggcaatatcggcaccgatttaatgatc
aaaattctgcgccacgggcagcacctggagatggcggtaatggtcggcatcgaccctgag
tccgacggcctggcccgcgcccggcgcatgggcgtcgccaccacgcacgagggcgttggc
ggcctgatgcagatggcggaattcgccgatatcgatgtggtttttgacgccaccagcgcc
ggagcgcacgtgaaaaacgacgccgcgctgcgggaagccaggccggggatccgggtgatc
gacctgaccccggcggccatcggcccgtactgcgtgccggtggtcaatctcgaggccaat
ctggccgaaggcaacgtcaatatggtgacctgcggcggccaggccaccatcccgatggtg
gcggcggtctcccgggtggcaaaagtgcactatgcggagatcatcgcctcgattgccagc
aaatccgccgggccggggacgcgcgccaacattgatgaatttaccgaaaccacctcgcag
gccattgagaaagtgggcggcgcggcgaaaggcaaagcgattatcgtgctgaatccggcg
gagccgccgctgatgatgcgcgacaccgtttatgtcctgagcgaagcggcatcgcagcag
gcgattgccgcgtcgatcgccgagatggcggcggcggtacaggcctacgtgccgggatat
cgcctgaagcagcaggtgcagtttgaggtcatcccggaagataaaccggtaaacctgccg
ggcgtcggccgcttctccggcctgaaaacggcggtttatctcgaggtcgaaggggcggcg
cactatctgccagcctacgcgggtaacctcgatattatgacgtcggcggcgctggcgacg
gcggaaaaaatggcccaggcgatgaacgacgcggcgggagaagcagcatga

DBGET integrated database retrieval system