KEGG   Klebsiella oxytoca E718: A225_3491Help
Entry
A225_3491         CDS       T02173                                 

Definition
alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
koe  Klebsiella oxytoca E718
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:koe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    A225_3491
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A225_3491
   00620 Pyruvate metabolism
    A225_3491
   00650 Butanoate metabolism
    A225_3491
  Lipid metabolism
   00071 Fatty acid degradation
    A225_3491
  Amino acid metabolism
   00350 Tyrosine metabolism
    A225_3491
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A225_3491
   00626 Naphthalene degradation
    A225_3491
Enzymes [BR:koe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A225_3491
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     A225_3491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3675599..3678274
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFSSHGGYLLQGQELKAVQNIILKNGALNAAIVGQP
AYKIAELAGFTVPVSTKILIGEVTDVDESEPFAHEKLSPTLAMYRAKNFEDAVDKAEKLV
AMGGIGHTSCLYTDQDNQPERVAYFGQLMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLTIVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMEMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLTAPGDRTAAKIEKLLGWLDEIKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLIAELKQILLDTFYGRNYVEGSVEEKKEVAPAKAEKKAKKSA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtcgagcgcgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagaacaagtagacaaaatcttccgcgccgccgctctg
gccgctgcagatgctcgaatccctctcgccaagatggccgttgccgaatccggcatgggc
atcgtcgaagataaagtgatcaaaaaccactttgcttccgaatacatttataacgcctat
aaagatgaaaagacctgcggcgtcctgtctgaagatgacaccttcggtaccatcaccatc
gctgagccgattggtattatctgcggtatcgtcccgaccactaacccaacttcaaccgct
atctttaaatctctgattagcctgaagacccgtaacgccatcatcttctctccgcatccg
cgagctaaagatgcgaccaacaaagcggctgatatcgtactgcaggcagctatcgcagcc
ggtgcgccgaaagatctgattggttggattgaccagccttccgttgaactgtcaaatgcg
ctgatgcaccatccggatatcaacctgatccttgcgaccggcggtccgggcatggttaag
gcggcgtatagctccggtaaacctgccatcggcgtaggcgcaggtaacacgcctgttgtt
atcgatgaaacggctgatatcaagcgtgccgttgcttccgtcctgatgtctaaaaccttc
gataacggcgttatctgtgcttctgagcaatccgttgtggttgtagattccgtatacgat
gccgttcgcgaacgtttctccagccacggcggctatctgctgcagggccaggagctgaag
gctgttcagaatatcatcctgaaaaacggcgccctgaacgctgcaatcgtaggtcaaccg
gcgtataaaatcgctgaactggccggcttcaccgtccctgtttccaccaaaattctgatt
ggtgaagtcaccgacgttgatgaaagcgaaccgtttgcccacgaaaaactgtctccgacg
ctggcaatgtaccgtgcgaagaacttcgaagacgcggttgataaagctgaaaaactggtg
gcaatgggcggtatcggtcatacctcttgcctgtataccgaccaggacaaccagccagaa
cgcgttgcttacttcggtcagctgatgaaaaccgcacgtatcctgatcaacacccctgct
tctcagggtggtatcggtgacctgtataacttcaaactcgcaccttccctgactctgggt
tgtggttcatggggtggtaactccatctctgaaaacgttggtcctaagcacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgtcgtggctcactgccaatcgcgctggatgaagtgattactgatggtcacaaa
cgcgcgctgatcgtgaccgaccgcttcctgttcaacaacggctatgctgaccagatcacc
tctgtgctgaaagcggctggcgttgaaaccgaagttttctttgaagtggaagctgacccg
acgctgaccatcgttcgtaaaggcgctgagctggcgaactccttcaaaccagacgtgatt
atcgcgctgggcggcggttccccgatggatgcggcgaaaatcatgtgggttatgtacgag
cacccggaaacccacttcgaagaactggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagccaaaatggtcgccatcaccacgacttccggt
accggttctgaagttacgccgttcgccgttgttaccgatgatgcaaccggtcagaaatac
ccgctggcagactatgccctgactccggatatggcgattgttgatgccaacctggtcatg
gaaatgccgaagtcactgtgtgctttcggtggtctggatgcggtgactcatgccctggaa
gcttacgtttccgtactggcttccgagttctctgacggccaggcgctgcaggctctgaaa
ctgctgaaagaaaacctgccagcgtcctaccacgaaggttctaagaacccggtagcgcgt
gagcgtgtgcacagtgctgcgaccatcgccggtatcgcgtttgcgaacgccttcctcggg
gtatgtcactcaatggcgcacaagctgggctctcagttccacattcctcacggtctggcg
aacgccctgctgatcagcaacgttattcgctataacgctaacgacaacccgactaaacag
acagcattcagccagtacgaccgcccgcaggcacgtcgtcgctacgctgaaatcgcggac
catctgggtctgactgcaccgggtgaccgtaccgcagcgaaaatcgaaaaactgcttggc
tggttggacgaaatcaaagctgagctgggtattcctaagtctatccgcgaagctggcgtg
caggaagctgatttcctggcccacgttgacaagctgtctgaagacgcatttgacgaccag
tgcaccggcgctaacccgcgctacccgctgatcgctgagctgaaacagattctgctggat
acgttctacggacgtaattacgttgaaggcagcgtggaagagaaaaaagaagtcgcgccg
gctaaagctgagaagaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system