KEGG   Klebsiella oxytoca E718: A225_4714Help
Entry
A225_4714         CDS       T02173                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
koe  Klebsiella oxytoca E718
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:koe00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A225_4714
Enzymes [BR:koe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     A225_4714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4954887..4955534)
Genome map
AA seq 215 aa AA seqDB search
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTEAHIVYIDA
EGQHEQGKLPSSEWRFHMAAYQTRPDAHAVVHNHAVHSTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEHVAVALKNRKATLLQHHGLIACEENLEKALWLAHEVEVLAQL
YLSTLAITDPVPVLGDEAIAIVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaaatagactggcccggcagattattgatacctgcctggaaatgacccgcctg
gggttaaatcagggaaccgccggtaacgtgagcgtgcgttatcaaggggggatgctgatc
acgccaacgggtattccttacgaaaagctgacggaagcgcacattgtgtatatcgatgcc
gaaggtcagcatgaacagggcaaactgccgtccagcgagtggcgttttcatatggcggct
tatcagacgcggcctgatgctcacgcggtggtacataatcatgcggttcactctacggcg
gtgtcgatcctcaatcgtcccattcccgccattcactatatgattgcggcggcgggcggt
aactctatcccctgtgcgccctacgccacgtttggtacccgcgagctgtctgagcatgtg
gccgtggcgctgaaaaaccgcaaagcgacgctgctgcagcaccatggcctgatcgcttgt
gaagagaatctggagaaggccctgtggctggcgcatgaagttgaggtgctggcgcagctt
tatctcagcactctggccatcaccgacccggtgccggttcttggcgacgaggccattgct
atcgtgctggagaaattcaaaacctacggattgcgtatcgaagagtga

DBGET integrated database retrieval system