KEGG   Klebsiella oxytoca E718: A225_5399Help
Entry
A225_5399         CDS       T02173                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
koe  Klebsiella oxytoca E718
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:koe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A225_5399
Enzymes [BR:koe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     A225_5399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5616943..5619036)
Genome map
AA seq 697 aa AA seqDB search
METKRLDNAALAAGISPSYINAHGKPQSIAAVTKQRLLDAMHRTASAVKAAVNPLPAVQV
FTYGKKMSLPVAGQGEFHWILTTEEGKQYQGQARGGETLPLPARLPEGYHTLTLTQDGDR
WHCRVIVAPARCYEPQALKDGKKLWGTCVQLYTLRSEKNWGIGDFGDLRAMLPEIARRGG
AFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFRRSKEAQKWWQSPATQQ
ALQAARQTDDVDYTAVTALKLTALRMAWKGFSARNDETTAEFRQFVAREGESLYWQAAFD
ALHAWQVKQDPLRWGWPAWPKAYQDTDSPEVKAFCTEHADEVNFYLWLQWLAFTQFAECW
HTSQNDAMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMD
PHIIVARAYEPFVELLRANMQNCGALRIDHVMSVLRLWWIPYGETADHGAYVQYPVDDLL
SILALESKRHRCMVIGEDLGTVPVEIVGKLRKSGVYSYKVLYFENDHEKTFRAPKAYPEQ
SMAVATTHDLPTLRGYWESGDLTLGKSLGLYPDAVVLRGLYQDRERAKQGLLDALHRYGC
LPKRTGHKASLMAMTSTLNRGMQRYIADSNSALLGLQPEDWLEMAEPVNIPGTSTEYPNW
RRKLSTTLEAMFADEQVNKLLKDLDKRRKAASKKKPA
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggagactaaacgccttgataacgctgccctggcggcgggaataagcccaagctacatc
aacgctcatggaaagccgcagtccattgctgcggtgaccaagcagcggctgcttgatgcg
atgcatcgtacagcgagcgccgtgaaggcggcggttaacccgctgcctgcggtgcaggtg
ttcacctacggcaaaaagatgtctctgccggtggcgggccagggggagttccactggatc
ctcaccaccgaagaagggaaacagtatcagggccaggcgcgcggcggtgaaacgctgccg
ctgccggcaagattgccggaagggtaccacacgctgacgctgactcaggacggcgaccgc
tggcactgccgggtcatcgtcgcgcccgcgcgctgctacgaaccgcaggcgctgaaggat
ggcaagaagctgtggggaacctgcgtacagctgtatacgctgcgctcggagaagaactgg
gggattggcgacttcggcgatttacgcgcgatgctgccggaaatcgcccgccgcggcggt
gcgtttatcgggcttaacccgattcacgcgctctatccggctaatccggagagcgccagt
ccgtacagcccctcttcgcgccgctggctcaacgttatctatatagacgtcaatgcggta
gaggatttccgacgcagcaaagaagcgcagaaatggtggcaatcaccggctacgcagcag
gccctacaggccgcgcgtcagaccgatgatgttgactacaccgccgtgaccgcccttaag
ctcactgcgctgcgcatggcctggaaaggtttttccgcacgtaacgatgagacgacggcg
gagttccgtcagtttgtggcgcgcgagggggaaagcctgtactggcaggcggcgtttgac
gcgctgcacgcctggcaggttaagcaggatccgctgcgctggggctggcccgcgtggccg
aaggcttatcaggataccgatagcccggaggttaaagcgttctgcaccgaacacgccgat
gaggtgaatttttacctgtggctgcagtggctcgctttcactcagtttgccgaatgctgg
cataccagccagaacgacgccatgccgatcggcctgtatcgcgacctggcggtgggcgtt
gcggaaggcggggcggaaacctggtgcgatcgcgagctgtactgcctgaaagcttccgtc
ggcgcgccgccggatatcctgggcccgctggggcaaaactggggcctgccgccgatggat
ccgcatatcatcgtggcgcgcgcctatgagccgtttgtcgaactgctgcgcgccaacatg
caaaactgcggggcgctgcgcatcgatcacgtgatgtcggtgctgcgtttgtggtggatc
ccttacggtgaaacggccgatcacggcgcctatgtgcagtatccggtcgacgatctgttg
tcgattctggcgctggagagtaagcgtcatcgctgtatggtgatcggcgaggatctggga
accgtaccggtagagatcgtcggtaagctgcgtaaaagcggcgtttactcttacaaagtg
ctctatttcgaaaatgaccacgagaagactttccgtgcgccgaaggcgtatccggagcaa
tcaatggctgtggctacgacgcatgacctgccaacgctgcgcggctactgggaaagcggc
gacctgacgctgggtaaatcgcttggcctgtatccggatgcggtggtactgcgcggactg
tatcaggaccgcgagcgggcgaagcaggggctgctggacgctctgcaccgctacggctgt
ctgccgaagcgtaccgggcacaaagcgtcgctgatggcgatgacgtcgaccctcaatcgt
ggaatgcagcgctatattgccgacagcaacagcgccctgctgggcctgcagccggaagac
tggctggagatggccgagccggtcaatattccgggcaccagtacggagtatccaaactgg
cgtcgcaagctctccaccaccctcgaggcgatgtttgccgatgagcaggtgaataagctg
cttaaggatctggataagcggcgcaaggcggcgagtaagaagaagccagcgtga

DBGET integrated database retrieval system