KEGG   Klebsiella oxytoca E718: A225_5543Help
Entry
A225_5543         CDS       T02173                                 

Definition
(GenBank) Endoglucanase precursor
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
koe  Klebsiella oxytoca E718
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5774717..5775826)
Genome map
AA seq 369 aa AA seqDB search
MMNAVRGVVLSVLMLAAAQVSAACQWPAWEQFKKEYVSAEGRIIDPSDARKITTSEGQSY
GLFFALAANDRDGFRKLFEWTQNNLAEGDLRAHLPGWLWGKKSDDEWTVLDNNSASDSDL
WIAWALLEAGRLWDTPQYTEVGKALLARIADEEVATVPGLGPMILPGRVGFVDDRGWCFN
PSYLPPQLATYFAAFGAPWPKIRDGNLRLLLETAPKGFSPDWVRYEKSKGWQLKADKPII
GSYDAIRVYLWVGMLDDGDKQKARLLARFKPMATRTIDQGVPPEKTNIATGKTTGNGPVG
FSAALLPFLQKEDARAIQRQRVADNYPGADAYYSAVLTLFGQGWDQHRFRFTAGGELRPD
WNQECTSSH
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgcggtgcgcggtgtggtgttatcggtattgatgctggcggcggcgcaggtg
agcgccgcctgccagtggccggcctgggagcagtttaaaaaagagtatgtcagcgccgaa
gggcgaattatcgaccccagcgatgcgcgaaaaatcaccacctcggaagggcaaagctac
gggctgttctttgctctggcggctaacgatcgcgacggcttccgcaagctgttcgagtgg
acgcaaaacaaccttgccgagggcgatttgcgcgcgcatctcccgggctggctgtggggg
aaaaagagcgatgacgagtggacggtgctggacaacaattcagcctcggactccgatttg
tggatagcctgggcactgctggaggccggacgtctgtgggacacgcctcagtacaccgag
gtaggcaaggcactgctggcgcgcattgccgacgaagaggtcgccaccgtaccggggctg
gggccgatgattctgccggggagagtcggcttcgtcgatgaccgcggctggtgttttaat
cccagctatctgccgccgcagctggcgacctactttgccgcgtttggcgctccctggccg
aagatacgcgacggcaatctgcgtctgctgctggaaaccgcgccgaaaggtttttcgcct
gactgggtgcgttacgaaaaaagcaaaggctggcagctgaaagcggataaacccattatc
ggcagctatgacgccattcgcgtctatctgtgggtcggtatgctcgatgacggcgataag
caaaaagctcgcctgttggcgcgttttaaaccgatggcgacccggacgattgaccagggc
gtgccgccggaaaaaaccaacatcgcgaccggtaaaactaccggcaacggtccggttggc
ttctccgctgcgctactgcctttcttgcagaaggaagatgcgcgcgccattcagcgccag
cgcgtcgccgataactatcccggcgcggatgcttactacagcgcggtcctgacccttttc
ggccagggatgggatcaacaccgttttcgcttcaccgccggtggcgaattacggcctgac
tggaaccaggaatgcacaagttctcactaa

DBGET integrated database retrieval system