KEGG   Klebsiella oxytoca E718: A225_5835Help
Entry
A225_5835         CDS       T02173                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
koe  Klebsiella oxytoca E718
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:koe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A225_5835
Enzymes [BR:koe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     A225_5835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6082790..6083764
Genome map
AA seq 324 aa AA seqDB search
MRHRIPVARFPGILIMKTAGKLVVLGSINADHILNLDAFPTPGETVTGHHYQVAFGGKGA
NQAVAAGRSGANIAFIACTGDDDIGERVRRQLESDNIDVAPIRAVAGESTGVALIFVNAE
GENTIGIHAGANAALSVAQVYAEKERIAGAQALLMQLESPLESVLAAAKIAHQNQTSVIL
NPAPARELPDELLTLVDIITPNETEAEKLTGVRVESDDDAAKAAKVLHDKGIGTVIITLG
SRGVWASSEGEGRRVPGFKVQAVDTIAAGDTFNGALVTALLEGSELAQAIRFAHAAAAIA
VTRKGAQPSVPWRKEIDEFLRQQG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaccggattccggtggcgcgctttccgggaatattgattatgaaaaccgcaggc
aaacttgtcgtccttggcagtatcaacgccgatcacatcctgaatcttgacgccttccca
acgccgggtgaaaccgttaccggtcatcactatcaggtcgcttttggcggtaagggcgca
aaccaggcggttgctgccggacgcagcggagccaatatcgcctttatcgcctgtaccggc
gatgacgatattggcgaacgcgttcgtcgtcagttggaaagcgataatatcgacgtcgcg
ccgatcagagccgtagccggagaatcaaccggcgtggcgctgatttttgttaacgctgaa
ggtgagaatactatcggtattcatgctggcgctaacgccgcgctcagcgtggcgcaggtt
tatgcggaaaaagagcgtattgccggcgcgcaggcgctgctgatgcagctggaatcgccg
ctggaaagcgtactggccgcggcgaaaatcgctcaccagaatcaaacctcagttatcctc
aatccggcgccggcacgtgaactgcccgatgaactgctcacgctggtggatatcattacc
cctaacgagaccgaagcggaaaagctcaccggcgttcgcgtagaaagcgacgatgatgcg
gcaaaagccgccaaagtgctccatgataaaggtattggtacggtgatcattacgcttggc
agccgtggcgtatgggccagcagcgaaggtgaaggtcgtcgggttcccggttttaaagtg
caggcggttgataccatcgccgctggcgatacctttaatggtgcgctggtcaccgcgctg
cttgaaggtagcgaactggcgcaggcgattcgttttgcccatgccgccgccgctatcgcc
gtcacccgcaaaggggctcagccctccgtgccctggcgaaaagaaatagacgaattttta
cgtcaacaggggtaa

DBGET integrated database retrieval system