KEGG   Kosmotoga olearia: Kole_0039Help
Entry
Kole_0039         CDS       T00914                                 

Definition
(GenBank) peptidase M42 family protein
Organism
kol  Kosmotoga olearia
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(45631..46665)
Genome map
AA seq 344 aa AA seqDB search
MKLERLKELSELPGISGFEEKVADYIEEKIKDKVDKYWRDNVGNLIALKKGKGNGKKLML
LAHMDEVGLMVKRVNEDGTLAIRAVGGLAPRVLIGKKVLVGPDLIPGVIGFDAIHIQEPA
TVLKSPSYDSLSVYLGVSSKDEVKNVRIGDPVFFSTKYEEVGNYAIGKAFDDRSGCEVLL
SVLDDILENPVDYDIYFAWVVQEEVGLRGSGVAAAQIKPDAALVFENTTAGDNPEMPESR
WSTRLGEGPALTFAHSGLVLDRKIFETIVDTAKRYDIPFQYKSRTVGGTDAARLARTLRG
IPSGVISTPSRYIHSPVSVIDINDFLKVVKLAKILVREGKVLSE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgagagactgaaagaactttccgaacttcccggaatttcaggttttgaagag
aaggtcgcggattatatagaagaaaagataaaggataaggtcgataagtactggcgtgac
aatgtgggcaatcttattgcactgaagaaaggaaaaggtaacggcaagaagctcatgctt
ctggctcatatggatgaggttgggctcatggtcaagagggtgaatgaagacggcacgctg
gcgataagagctgtaggtggattggctccaagggttctgatcggcaagaaggtgctggtg
ggacctgaccttatccccggggtaattgggttcgatgcgatacatattcaggaacccgca
actgtcttgaagtcaccgagttacgattctttatctgtttatcttggtgtttcgagtaaa
gatgaagtgaagaacgtgagaattggtgaccctgtttttttcagcacgaaatatgaagag
gtcggaaattacgcgatagggaaggctttcgatgaccgtagcggttgtgaggttttgctt
tcagttcttgatgacattcttgaaaatcctgttgactatgatatctactttgcctgggtt
gtccaggaagaggtagggcttagaggaagcggcgttgctgctgcccagattaaacccgat
gcggctctcgtttttgagaataccaccgcaggagacaacccggaaatgcctgagtcgagg
tggtctacgcgcctcggtgaagggccagcgttaacctttgcgcattcagggctggtactg
gacaggaagatcttcgaaaccatagtcgatacggctaaaagatatgacattcctttccag
tacaaaagcagaacagtcggcggaacggatgccgcacgactggcgagaacactcagaggc
attccttccggggtgatttcaaccccatcacgttacatacattcgcctgtttcagtgata
gatatcaatgatttcttgaaagttgtaaaacttgcgaaaatcctggttagggaagggaag
gtgttaagcgaatga

DBGET integrated database retrieval system